KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997475
Entry
102997475         CDS       T03086                                 

Gene name
PPP3CA
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04114  Oocyte meiosis
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04720  Long-term potentiation
bacu04724  Glutamatergic synapse
bacu04728  Dopaminergic synapse
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04924  Renin secretion
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05031  Amphetamine addiction
bacu05152  Tuberculosis
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102997475 (PPP3CA)
   04310 Wnt signaling pathway
    102997475 (PPP3CA)
   04370 VEGF signaling pathway
    102997475 (PPP3CA)
   04020 Calcium signaling pathway
    102997475 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    102997475 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102997475 (PPP3CA)
   04218 Cellular senescence
    102997475 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102997475 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    102997475 (PPP3CA)
   04660 T cell receptor signaling pathway
    102997475 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    102997475 (PPP3CA)
   04659 Th17 cell differentiation
    102997475 (PPP3CA)
   04662 B cell receptor signaling pathway
    102997475 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102997475 (PPP3CA)
   04921 Oxytocin signaling pathway
    102997475 (PPP3CA)
   04924 Renin secretion
    102997475 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102997475 (PPP3CA)
   04728 Dopaminergic synapse
    102997475 (PPP3CA)
   04720 Long-term potentiation
    102997475 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102997475 (PPP3CA)
   04380 Osteoclast differentiation
    102997475 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102997475 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102997475 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    102997475 (PPP3CA)
   05020 Prion disease
    102997475 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    102997475 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102997475 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102997475 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102997475 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    102997475 (PPP3CA)
   05163 Human cytomegalovirus infection
    102997475 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102997475 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    102997475 (PPP3CA)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102997475 (PPP3CA)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102997475 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 102997475
NCBI-ProteinID: XP_007172975
UniProt: A0A383ZCR9
LinkDB
Position
Un
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDTNLNSINKTLASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacggcaaaagaagtgtttgataacgatgggaaa
cctcgtgtggatatcttaaaggcacacctcatgaaggagggcaggctggaagagagcgtt
gcattgagaataatcacagagggggcttcaattcttcgacaggaaaaaaatttgctggat
attgatgcaccagtcacagtttgcggggacatccatggacagttctttgacttgatgaag
ctctttgaagtgggcggatctcccgccaacactcgctacctcttcttaggggactatgta
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggctttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtttatgacgcctgcatggat
gcctttgactgcctgcccctggctgccctgatgaaccagcagttcctatgtgtacacggc
ggtttgtctccagagattaacaccttagatgatatcagaaaattagaccgattcaaagaa
ccacccgcttatggacctatgtgtgatatcctgtggtcagaccccctggaggattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcatacttctac
agttacccggctgtatgtgaattcttacagcacaataacttgttatctatactccgagcc
catgaagcccaagacgcagggtaccgcatgtacaggaaaagccaaacaacaggcttccct
tctctcattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgtcatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgttttcacttggtccctgccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagatgatgaactagggtcagaa
gaagatggatttgatggtgcaacggctgcagcccgcaaggaggtgataaggaacaagatc
cgagcaatcggcaagatggccagagtgttctcggttctcagagaagagagtgagagtgtg
ctgacgctgaaaggcctgacgcccacgggcatgctccccagtggagtgctctctggaggg
aaacaaaccctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagatcgaattaac
gagaggatgccacctcgcagagatgccatgccctctgacaccaaccttaactccatcaac
aagactctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatata
cagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008480
Entry
103008480         CDS       T03086                                 

Gene name
PPP3CC
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04114  Oocyte meiosis
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04720  Long-term potentiation
bacu04724  Glutamatergic synapse
bacu04728  Dopaminergic synapse
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04924  Renin secretion
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05031  Amphetamine addiction
bacu05152  Tuberculosis
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103008480 (PPP3CC)
   04310 Wnt signaling pathway
    103008480 (PPP3CC)
   04370 VEGF signaling pathway
    103008480 (PPP3CC)
   04020 Calcium signaling pathway
    103008480 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    103008480 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103008480 (PPP3CC)
   04218 Cellular senescence
    103008480 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103008480 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    103008480 (PPP3CC)
   04660 T cell receptor signaling pathway
    103008480 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    103008480 (PPP3CC)
   04659 Th17 cell differentiation
    103008480 (PPP3CC)
   04662 B cell receptor signaling pathway
    103008480 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103008480 (PPP3CC)
   04921 Oxytocin signaling pathway
    103008480 (PPP3CC)
   04924 Renin secretion
    103008480 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    103008480 (PPP3CC)
   04728 Dopaminergic synapse
    103008480 (PPP3CC)
   04720 Long-term potentiation
    103008480 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    103008480 (PPP3CC)
   04380 Osteoclast differentiation
    103008480 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103008480 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103008480 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    103008480 (PPP3CC)
   05020 Prion disease
    103008480 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    103008480 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    103008480 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103008480 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103008480 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    103008480 (PPP3CC)
   05163 Human cytomegalovirus infection
    103008480 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008480 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103008480 (PPP3CC)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103008480 (PPP3CC)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103008480 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 103008480
NCBI-ProteinID: XP_007167932
UniProt: A0A383YYH6
LinkDB
Position
Un
AA seq 583 aa
MAAAPLGLLVQDRGAAVRCSRPGRRRQPRRSQLQEGQADKGKPLSEAEAEGSARARRAAA
RAESLRAKAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKIINDGAAIL
RQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLF
LWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDCLPLAALLN
QQFLCVHGGMSPEITCLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNT
VRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYL
DVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNIC
SDDELISDDEIEDHYISSYQKGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKG
LTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLDRINERMPP
RKDSQYFDGPVKLVQPNAAHRSDKGRRASNDSEPCCGTGGSKT
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggccgctgctccactggggcttttggtgcaggaccgaggggccgctgttaggtgctcc
aggcccgggcggcgcaggcagccgcgaaggagtcagctgcaggaggggcaggcagacaag
ggaaaaccactgtcggaagctgaagcggaaggaagcgcgcgtgcgcggagggcggccgcg
cgggccgagagcctccgcgcgaaggctgtcccctttcctccaacacagcggcttactttg
aaggaagtatttgagaatgggaaacctaaaattgatgttttgaaaaaccatttggtgaag
gaagggcgactggaagaggaagtagccttaaagataatcaatgatggggctgccatcctg
agacaagagaagactatgatagaagtagatgctccaatcacagtatgtggtgacattcat
ggacaattttttgacctgatgaagttgtttgaagttggaggatcacctagtaatacacgc
tacctctttctgggtgactatgtggacagaggctatttcagtatagagtgtgtgctgttt
ttatggagtttaaagattaatcatcccaaaacattgtttctgcttcgaggaaatcatgaa
tgcaggcatcttacagaatatttcaccttcaaacaggaatgtcgaatcaaatattctgaa
caggtatatgatgcgtgtatggaaacatttgactgtcttcctcttgctgccctcttaaac
cagcagtttctgtgtgtacatggaggaatgtcacctgaaattacttgtttagatgacatt
cggaaattagacaggtttaaagaacctccagcctttgggccagtgtgtgacctgctttgg
tctgatccctcagaggattatggcaatgaaaagaccttggaacactatacccacaacacg
gtccgagggtgctcttatttttacagttaccctgcagtttgtgaatttttgcagaacaat
aatctgttatcaataatcagagcccatgaagcccaagatgctgggtatcgaatgtacagg
aagagccaaacgacaggctttccatcactcattactattttctctgcccccaattaccta
gatgtctataacaataaagctgctgtgttaaaatatgaaaacaatgtcatgaatatcagg
cagtttaactgttctccacacccatactggcttccaaactttatggatgttttcacgtgg
tctttgccttttgttggggaaaaagtcacagagatgctggttaacattctcaacatatgc
tctgatgatgaattgatttccgatgatgaaattgaagatcactacatttcaagctatcag
aaaggaggcactacagttcgaaaggagatcatcaagaataaaatcagagccattgggaag
atggcacgggtcttttcaattcttcgggaagagagtgagagtgtgctgactctcaagggc
ctgactcctacaggtacgcttcctttgggtgtactctcaggaggaaagcagactattgag
acagccacagtagaagcggtagaggcccgggaagccatcagagggttctcgcttcagcac
aggatccggagttttgaagaagcccgaggtctggaccgaattaatgagcggatgccaccc
cgcaaagatagccagtactttgatgggccagtgaaattggtccaaccaaacgctgcgcac
aggagtgacaaggggagaagagccagtaatgactcagagccctgctgtggcacaggtgga
tccaagacttaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009446
Entry
103009446         CDS       T03086                                 

Gene name
PPP3CB
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04114  Oocyte meiosis
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04720  Long-term potentiation
bacu04724  Glutamatergic synapse
bacu04728  Dopaminergic synapse
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04924  Renin secretion
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05031  Amphetamine addiction
bacu05152  Tuberculosis
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103009446 (PPP3CB)
   04310 Wnt signaling pathway
    103009446 (PPP3CB)
   04370 VEGF signaling pathway
    103009446 (PPP3CB)
   04020 Calcium signaling pathway
    103009446 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    103009446 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103009446 (PPP3CB)
   04218 Cellular senescence
    103009446 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103009446 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    103009446 (PPP3CB)
   04660 T cell receptor signaling pathway
    103009446 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    103009446 (PPP3CB)
   04659 Th17 cell differentiation
    103009446 (PPP3CB)
   04662 B cell receptor signaling pathway
    103009446 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103009446 (PPP3CB)
   04921 Oxytocin signaling pathway
    103009446 (PPP3CB)
   04924 Renin secretion
    103009446 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    103009446 (PPP3CB)
   04728 Dopaminergic synapse
    103009446 (PPP3CB)
   04720 Long-term potentiation
    103009446 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    103009446 (PPP3CB)
   04380 Osteoclast differentiation
    103009446 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103009446 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103009446 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    103009446 (PPP3CB)
   05020 Prion disease
    103009446 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    103009446 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    103009446 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103009446 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103009446 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    103009446 (PPP3CB)
   05163 Human cytomegalovirus infection
    103009446 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103009446 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103009446 (PPP3CB)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103009446 (PPP3CB)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103009446 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 103009446
NCBI-ProteinID: XP_007166659
UniProt: A0A383YVC4
LinkDB
Position
Un
AA seq 528 aa
MASPEPGRAAPSPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYIPXXXXXXECKI
KYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMC
DLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGY
RMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMD
VFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMA
RVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI
CSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHGAQ
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggcctccccggagccgggccgggctgcaccgtccccacccccgcccccgccgcctcct
cccggggctgaccgagtcgtcaaagctgtccctttccccccaacgcatcgcttgacatct
gaagaagtttttgatatggatgggatacccagggttgatgttttgaagaaccacttagta
aaagaaggtcgggtagatgaagaaattgcacttagaattatcaatgagggtgctgccatt
cttcggagagagaaaaccatgatagaagtagaggctccaattacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggtcctgaagattctatacccaagcacattatttcttctgagaggcaaccat
gaatgcagacaccttactgaatatattcccnnnnnnnnnnnnnnnnnggaatgtaaaatt
aaatattcagaaagagtctatgaagcttgtatggaagcttttgatagcctgcctcttgct
gcacttttaaaccaacagtttctttgtgttcatggtggactttcaccagaaatacacaca
ctggatgatattaggagattagatagattcaaggagccacctgcatttggaccaatgtgt
gacttgctatggtctgatccttctgaagattttggaaatgaaaaatcacaggaacatttt
agtcacaatacagttcgaggatgttcttatttttataactatccagcagtgtgtgaattt
ttgcaaaacaataatttgttatcgattattagagctcatgaagctcaagatgcaggctat
agaatgtacagaaaaagtcaaactacagggttcccttcattaataacaattttttcggca
cctaattacttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtg
atgaatattcgacaatttaactgttctccacatccttactggttgcccaattttatggat
gtcttcacatggtctttaccatttgttggagaaaaagtgacagaaatgttggtaaatgtt
ctgagtatttgctctgatgatgaacttatgactgaaggagaagaccagtttgatgtaggt
tcagctgcagcccggaaagaaatcataagaaacaaaattcgagcaattggcaagatggca
agggtcttctctgttctcagggaggagagtgaaagtgtgctgacactcaagggcctgact
cccacagggatgttgcctagtggagtgttagctggaggacggcagaccctgcaaagtgcc
acagttgaggctattgaggctgaaaaagcaatacgaggattctctccaccacatagaatc
tgcagttttgaagaggcaaagggtttggataggatcaatgagagaatgccaccccggaaa
gatgctgtacagcaagatggtttcaattctctgaacaccgcacatgccactgagaaccac
gggactggcaaccatggtgcccagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009602
Entry
103009602         CDS       T03086                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04114  Oocyte meiosis
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04720  Long-term potentiation
bacu04724  Glutamatergic synapse
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04924  Renin secretion
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05031  Amphetamine addiction
bacu05152  Tuberculosis
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103009602 (PPP3R2)
   04310 Wnt signaling pathway
    103009602 (PPP3R2)
   04370 VEGF signaling pathway
    103009602 (PPP3R2)
   04020 Calcium signaling pathway
    103009602 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    103009602 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103009602 (PPP3R2)
   04218 Cellular senescence
    103009602 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103009602 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    103009602 (PPP3R2)
   04660 T cell receptor signaling pathway
    103009602 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    103009602 (PPP3R2)
   04659 Th17 cell differentiation
    103009602 (PPP3R2)
   04662 B cell receptor signaling pathway
    103009602 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103009602 (PPP3R2)
   04921 Oxytocin signaling pathway
    103009602 (PPP3R2)
   04924 Renin secretion
    103009602 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103009602 (PPP3R2)
   04720 Long-term potentiation
    103009602 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    103009602 (PPP3R2)
   04380 Osteoclast differentiation
    103009602 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103009602 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103009602 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    103009602 (PPP3R2)
   05020 Prion disease
    103009602 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    103009602 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    103009602 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103009602 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103009602 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    103009602 (PPP3R2)
   05163 Human cytomegalovirus infection
    103009602 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103009602 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103009602 (PPP3R2)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103009602 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Other DBs
NCBI-GeneID: 103009602
NCBI-ProteinID: XP_007198669
UniProt: A0A384BH92
LinkDB
Position
Un
AA seq 170 aa
MGNESSYPVEMCSHFGQDEIKQLGKRFKKLDSDSSGALSVVEFMFLSELQENPLVQRVTD
VFDTDGNREVDFGEFILGTSQFSGKGDKEQKLRFAFSIYDMDXDGYISNGELFQVLTMMV
GDNLKDWQLQQLVDKTIIVLGKDHDGKRSFQEFSAAVGSLESHKKLVTIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgagtccagttacccggtagaaatgtgctcccactttggccaagacgaaatt
aaacagctgggcaagcggtttaagaagctggactcggacagttcgggcgctctgagcgtg
gtggagttcatgttcctgtcggagctacaggagaacccattggtgcagcgagtgacagac
gtcttcgacacagacggcaatagagaggtggacttcggggaattcatcctggggacctcc
cagttcagtggcaagggagacaaggagcagaagctgaggtttgctttcagcatctacgac
atggacnaagacggctacatttccaacggggagctcttccaggtgctgaccatgatggtg
ggggacaacctgaaagactggcagttacagcagctcgtggacaaaaccatcatcgtcctg
ggcaaggatcacgatgggaaaagatccttccaggaattcagtgctgctgttggaagcctg
gagagccacaagaagttggtgacaattgtgtga

DBGET integrated database retrieval system