KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997482
Entry
102997482         CDS       T03086                                 

Gene name
NCOR1
Definition
(RefSeq) nuclear receptor corepressor 1
  KO
K04650  nuclear receptor co-repressor 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04919  Thyroid hormone signaling pathway
bacu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102997482 (NCOR1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102997482 (NCOR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102997482 (NCOR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    102997482 (NCOR1)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102997482 (NCOR1)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 102997482
NCBI-ProteinID: XP_007174173
UniProt: A0A383ZG85
LinkDB
Position
Un
AA seq 2433 aa
MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPSTRHQQEFAVPDYRSSHLEVSQASQLLQQQ
QQQQLRRRPSLLSEFHPGSDRPQERRTGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQ
RVSAAVLPLVHTLPEGLRSSADAKKDPAFGVKHEAPSSPISGQPCGDDQNASPSKLSKEE
LIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY
DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR
KQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ
RVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM
NGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYL
TKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDE
KEDSKENTKEKDKTESTAEETEEREQATPRGRKTANSQGRRKGRVTRSMTSEAAAASAAA
AAATEEPPPPMPPPPEPVSTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEA
QCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEE
ENPEDSEVEAVKPGEDSTENAPPRGTTEPAAELEATPDAVPRASPSPAVASTKAAEDDSV
ETQANDSMAVDTAEPMDVEHEERGAEGISALDLPSAAKADAVDVEMPESSPSRVEGDPKD
RDLERSSEKPEPGDDDLGVAQQMSAPRPELPSDHDSSATCSADEDVDGEPERQRMFPVDS
KPSLLNPTGSILVSSPIKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGFALYQRH
IKAMHESALLEEQRQRQEQMDLERRSSASPRGAPKSPSREWEVLQPAPHQVITNLPEGVR
LPTTRPTRPPPPLIPSSKTTVASEKPSFILGGSISQGTPGTYLPSPNQASYAPEAAKPSA
GSISLGLPRQQEAAKPATVPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTTGAIQEGS
ITRGTPSSKLSVESIPSLRGSITQGTPALSQAGIPTEALVKGPISRLSIEESSPEKGREE
AASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGALKQGLSMRES
PVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESP
PVRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDVLTQESQKTPEVVQSTRPVVEGSIS
QGTPVKSDSSSGQSAIKHNVKSLVAGPSRLPRGLPPLEVRPESIKAVERGKYEDVKAGEP
VRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYEDASARRTPGSYASTASRGSPMMSRAP
DVTISSSKPTNHERKSTLTPTQRESITAKSPVPGVDPAVSHSPFEPHHRGGAPGEVYRSH
LPAHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQM
QVGLRPDVARGLSPREQQLGLPYPATRGIIDLTNMPPAILVPHPGGTSTPPMDRITYIPG
TQVTFPPRPYNSASMSPGHSTHLAAAANAEREREREKERERLAAASSDLYLRPGSEQPGR
PSSHGYVRSPSPSVRAQETLLQQRPSVFQGTNGTSVITPLDPSAQLRIMPLPAGGPSISQ
GLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQLEQ
KSLEAEKRPGQCLYTSSALPSGKPQPHSAVVYSEAGKEKGPPPKSRYEEELRTRGKTTIT
AANFIDVIITRQIASDKDARERGSQSSDSSGSLSSHRYETPGDAIEVISPASSPAPPPER
LQAYQPEVVKASQAENEACRQYEGPLHHYRPQPESPSPQPPPPPPSSQAEGVGQVPRTHR
LITLADHICQIITQDFARNQVPSQPPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQS
QSLHHQRPGSRVSPENLVDKSRGSIRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSVL
LLAQRGAEPAEQRNDSRSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDM
AAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFEDKVEDHGVAM
PQPLGGVPGGAGTSVVTSGEARREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLG
AERPSSASSVHSEGDYHRQMAGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPSAPTACXXX
XXXXXAPHPPSRIWDREPAPLLSAQYETLSDSD
NT seq 7302 nt   +upstreamnt  +downstreamnt
atgtcaagttcaggttatccccccaaccaaggagcgttcagcacagagcaaagtcgttat
cctccccactctgttcagtacacctttcccagcacccgccaccagcaggagtttgcagtc
cctgattatcgttcttctcatctcgaagtcagtcaggcctcccagctcttgcagcaacag
cagcagcagcagcttcgcagacgaccttccctgctttcagagtttcacccaggttctgac
aggcctcaagaaaggagaactggatatgagcagtttcacccaggcccttccccggtggat
catgattcactggaatccaagcgcccacgtctggagcaggtttctgattcccatttccag
cgggtcagcgctgcggtcttacctttagtgcacacgctgccagaagggttgaggtcttct
gcagatgctaagaaggatccagcatttggagtcaaacatgaagctccttcctctccaatc
tctgggcaaccatgtggagatgatcaaaatgcttcaccttcaaaactttcaaaggaagag
ttaatacagagtatggatcgtgtagatcgagaaattgcaaaagtagaacagcagatcctt
aaactgaaaaagaaacaacaacagctcgaagaagaagccgctaaacctccagagcctgag
aagcctgtgtcccctcctcccgtggagcagaaacaccgcagtattgtccaaattatttac
gatgaaaatcggaaaaaagcagaagaagctcataaaatatttgaaggtcttggcccaaaa
gttgaactgccactctataaccagccatcagataccaaggtgtaccatgagaacatcaag
acaaaccaggtgatgaggaaaaaactcattttattttttaaaagaagaaatcatgcaaga
aaacaaagggagcaaaaaatctgccaacgttatgatcagctcatggaggcatgggagaaa
aaagtggacagaatagaaaataatcctcggaggaaagctaaagaaagcaaaacaagggag
tattatgaaaagcagtttccagaaattcgaaaacaaagagaacagcaagaacggtttcag
cgagttgggcagaggggagctggtctttcagccaccattgctaggagtgaacatgagatt
tctgaaattattgatgggctctctgaacaggagaataatgagaaacaaatgcgacagctc
tctgtgatcccacctatgatgtttgatgcagaacagagaagggtcaagttcattaatatg
aatgggcttatggaggaccctatgaaggtttataaagataggcagttcatgaatgtttgg
actgaccatgagaaggagatctttaaggacaagtttatccagcatccaaaaaactttgga
ctgattgcatcttacttggaaaggaagagtgttcctgattgtgttttatattactactta
accaagaaaaatgagaattataaagccctagtaagacggaactatggaaaacgcagagga
agaaaccagcaaattgcccgaccctcacaagaagaaaaagtagaagaaaaagaagaagat
aaagcagaaaaaacagaaaaaaaagaggaggaaaagaaagatgaagaagaaaaagatgaa
aaggaggactctaaagaaaacaccaaggaaaaggataagacagaaagtacggcagaagaa
actgaggagagagagcaggccacgccccggggccgaaagaccgccaacagtcagggccgc
cgaaagggccgggtcaccaggtccatgaccagcgaggccgcggccgccagcgctgcggct
gctgcagccaccgaggagccgcccccacccatgcctccgcctcccgaaccagtttctaca
gaacctgtagagacctctcgatggacagaagaagaaatggaagttgctaaaaaaggtcta
gtagaacatggtcgtaactgggcagcaattgccaaaatggtgggaactaaaagtgaagcc
caatgtaaaaacttctattttaactataagagacgacacaatcttgacaacctcttgcag
cagcataaacagaaagcctcacgaaagcctcgtgaagagcgagatgtgtctcagtgtgaa
agtgtagcttccaccgtttctgctcaggaggacgaggacatcgaagcctccaacgaagag
gaaaatcccgaggacagtgaagttgaagctgtcaagcccggcgaagacagcactgaaaat
gcgcctcctcgagggaccacggagcctgcggccgagctggaggccacacccgacgccgtg
cccagggcctctccctcgccggcagttgcgagcacaaaagcagccgaggatgacagtgtg
gagacccaggcgaacgacagcatggcagtggacacagcagagccgatggatgtggagcac
gaggagcgcggggctgaaggcatttccgccctggacctcccctcggccgccaaggctgac
gctgtggatgttgaaatgccagaaagcagtccctccagagtcgaaggggaccccaaagac
agagacctggagagaagcagcgagaagccggagcctggagacgacgacctaggggtggcc
cagcagatgagcgccccgaggcccgagctcccctctgaccacgactccagtgccacatgc
agtgccgacgaggacgtggacggggaacccgagaggcagcgaatgtttcctgtggattca
aaaccttcgttgttaaaccccactggatctatactggtctcgtccccaataaaaccaaat
ccactggacctgccacagcttcagcatcgagctgctgtcatcccgccaatggtttcctgc
accccatgtaacataccgattggaactccagtgagcggcttcgccctctaccagcgacac
atcaaagccatgcacgagtcggcgcttctggaggagcagcggcagaggcaggagcagatg
gacctggagcgcaggagctctgcgagcccgcgtggcgcccccaagagcccgagcagagag
tgggaagtcctccagcctgctccgcatcaagtgataactaacctccctgaaggggttcgg
cttccaacaactcgacccacgaggccacctcctcctctcatcccatcatccaaaaccaca
gtggcttcagaaaaaccatcttttatactgggaggctccatctcacagggaacacccggc
acttacttgccttctcctaatcaggcctcctacgctcccgaggcagcgaagccctcggcg
ggctccatctccctggggctgccgcggcagcaggaggccgccaagccagctactgtgccc
tacatcaagcaagaagagttttctccccgaagccagaactcgcaacctgagggtttattg
gtcagagcccaacatgaaggagtggtcagaggtaccacaggagccattcaagaaggaagt
ataactcgggggactccctccagcaaactttctgtggagagcatcccatccctccggggc
tctatcacccaggggaccccggctctgtcccaggctggcataccaactgaggctttggta
aagggacccatttctagactgtccattgaagagagcagtcctgagaaaggccgagaggaa
gctgcatccaaaggccatgttatttatgaaggcaaaagtggacacatcttatcttacgat
aatattaagaatgcccgagaagggacgaggagtccgagaacagctcatgaaatcagtctc
aaaagaagctatgaatcagtggaaggagctctaaagcaagggttgtccatgagggagtct
cctgtgtcagcaccgctggaggggctgatctgccgagcgttacccagggggagcccgcac
tctgacctcaaagaaaggactgtgctgtctggatccataatgcagggcacaccaagagcg
acaactgaaagttttgaagatggccttaagtaccccaaacagattaagagggagagtccg
cccgtacgagcgtttgaaggtgccatcaccaaaggaaaaccttacgatggcatcaccacc
atcaaagagatggggcgctccatccacgagatcccacggcaagatgttttaactcaggaa
agccagaaaaccccagaagtggtgcagagcacgaggcccgtggtcgagggctccatctcc
cagggcacacccgtcaagtctgacagcagctcaggccaatctgccatcaagcacaacgtc
aagtccttggtcgcggggcctagcagactgccccgtgggctgcctccactggaagtcagg
ccagagagcataaaagcggtcgaacgggggaaatacgaggacgtgaaagcaggcgagcct
gtgcgttcccggcacacgtcggtggtaagctctggcccctcggttctcaggtcaacgctt
cacgaagctcccaaagcacagctgagcccggggatttacgaggacgccagcgcgcggcgg
acaccggggagttacgccagcactgcatccagaggctcgcccatgatgagcagagcgccc
gatgttacgatttcttctagcaagcctaccaatcatgaaaggaaatcgacactgacccct
acccagagggaaagcatcacagcgaagtctccagtgcctggggtagaccctgcagtgagc
cacagcccttttgagccgcaccacaggggcggtgccccaggggaggtttaccggagccac
ctgcccgcacatctggacccagccatgccgtttcaccgggctctggatcctgcagctgct
gcttacctgttccagagacagctgtcaccaactccaggttaccccagtcagtaccagctc
tatgcgatggagaacacgcggcagacgatcctcaacgactacatcacctcacagcagatg
caagtgggcctgcgcccggacgtggccagagggctgtcgccccgggagcagcagctgggt
cttccgtacccagccaccaggggaatcattgacctgaccaatatgcccccagcaatttta
gtgcctcatccagggggaacaagcactcctcccatggacagaatcacttacattcctgga
acacaggtcaccttccctccccggccgtacaactctgcgtccatgtctccaggacactcg
acacacctcgctgctgcggcaaacgctgaaagagagcgggagcgggagaaggagcgggag
cgcctcgccgcagcctcctcggacctctacctgcggccaggctcggaacagcccggccgg
cccagcagccacggctacgttcgctctccgtctccttcagtcagagctcaggagaccctg
ctgcagcagagacccagcgttttccagggaaccaacggaaccagtgtgatcacacctttg
gacccgagcgcacagctacggatcatgccgctgcctgctgggggcccttccatcagccag
ggcctgccggcctcccgttacaatactgctgcggacgccctggctgctctcgtggacgcc
gcagcgtctgctccccagatggacgtgtccaaaacaaaagagagtaagcatgaagctgcc
aggttagaagaaaatttgaggagcaggtcagcagcagttagtgaacagcagctagagcag
aaaagcctggaggcggagaagagacccggtcagtgtctgtacacttcttcagccctgccg
agtggcaagccccagcctcattctgcagtagtttactctgaggctgggaaagagaaaggg
cctcctccaaaatccagatatgaggaagagctaaggacccgagggaagactaccattacc
gcagctaacttcatagacgtgatcatcacccggcaaattgcctcggacaaggatgcaagg
gaacgtggctcccagagttcagactcttccggtagcttatcttctcaccggtatgaaaca
cctggcgatgccattgaggtgataagccctgccagctcccccgcgccgccccccgagagg
ctgcaggcctaccagccggaggtcgtgaaggcgagccaggcagaaaacgaagcctgcagg
cagtacgaaggaccgctgcaccactatcggccgcagccggagtcgccctccccgcagccg
ccgccgccgcccccgtcttcacaggccgagggggtggggcaggtgcccaggacacaccga
ctcatcacacttgctgatcacatctgtcaaatcatcacgcaagattttgctagaaatcaa
gttccctcacagcctccccagcagcctcccacttctacattccaaaattcaccgtctgct
ttggtgtctacacccgtgaggactaaaacatcaaaccgttacagcccagaatcccagtct
cagtctcttcaccatcaaagaccaggttcaagggtctctccagaaaatcttgtggacaaa
tccaggggaagtatcaggcctggaaagtccccagagaggagtcacgtctctagcgagccc
tacgagcccatctccccaccccaggttccggtcgtgcacgagaaacaggacagcgtgctg
ctcctggcccagcgcggagccgagcccgcggagcagaggaatgattcccgatcaccaggg
agtataagctacttgccttcattcttcaccaagctggaaaacacctcacccatggttaaa
tcaaagaagcaggagatctttcgtaagttgaactcctctggtggaggtgactctgatatg
gcagctgctcagccaggaactgagatctttaacctgccggcagtcaccacctcaggctcc
gtgagctcccgaggtcattcctttgctgaccctgccagcaacctcgggctggaggacatc
atccggaaggcgctcatggggagctttgaggacaaagtggaggaccacggggtcgccatg
ccccagcccctggggggggtgcctggtggcgccggcacctcggtggtgaccagcggtgag
gcccggagagaggaaggggacccgtcacctcattcaggaggagtttgcaaaccaaagctg
atcagcaagtcaaacagcagaaaatcgaaatctcctatcccggggcaaggctacttggga
gctgaacggccctcctcggcctcctctgtgcactcagaaggcgattaccacaggcagatg
gcaggctgggcctgggaggacaggccctcctcaacaggctcgacgcagttcccctacaac
cccctgaccatgcggatgctcagcagcacgccgtccgcgcccaccgcctgtnnnnnnnnn
nnnnnnnnnnnnnncgcccctcacccgccgagcaggatctgggatcgggagccggccccg
ctgctctccgcgcagtatgagacgctgtccgacagcgactga

DBGET integrated database retrieval system