KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997538
Entry
102997538         CDS       T03086                                 

Gene name
CCNE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04110  Cell cycle
bacu04114  Oocyte meiosis
bacu04115  p53 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu04934  Cushing syndrome
bacu05161  Hepatitis B
bacu05162  Measles
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05206  MicroRNAs in cancer
bacu05215  Prostate cancer
bacu05222  Small cell lung cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102997538 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102997538 (CCNE2)
   04114 Oocyte meiosis
    102997538 (CCNE2)
   04115 p53 signaling pathway
    102997538 (CCNE2)
   04218 Cellular senescence
    102997538 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997538 (CCNE2)
   05206 MicroRNAs in cancer
    102997538 (CCNE2)
   05203 Viral carcinogenesis
    102997538 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    102997538 (CCNE2)
   05215 Prostate cancer
    102997538 (CCNE2)
   05222 Small cell lung cancer
    102997538 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102997538 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102997538 (CCNE2)
   05161 Hepatitis B
    102997538 (CCNE2)
   05162 Measles
    102997538 (CCNE2)
   05169 Epstein-Barr virus infection
    102997538 (CCNE2)
   05165 Human papillomavirus infection
    102997538 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bacu03032]
    102997538 (CCNE2)
   03036 Chromosome and associated proteins [BR:bacu03036]
    102997538 (CCNE2)
DNA replication proteins [BR:bacu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102997538 (CCNE2)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102997538 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102997538
NCBI-ProteinID: XP_007164996
UniProt: A0A383YQK4
LinkDB
Position
Un
AA seq 405 aa
MSRRSSRLQAKQQPQPSQTDSPQETQIIQAKKRKTAQDVKKRKEEKVIKKHQYEIRNCWP
PVLSGGISPCIIIETPHKETGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSQDVWLNMLK
KETRYVHDKHFEVLHSELEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
INKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELC
PVTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAA
ALCHFTSLEVVKKASGLEWDNISECVDWMVPFVSIVKSTSPVKLKVFKKISMEDRHHIQT
HTNYLAMLDEVNYMNTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacagcagccccagcccagtcagacggat
tccccacaagaaacccagataattcaggccaagaagagaaaaacggcccaggatgtcaaa
aaaagaaaagaggagaaggtcatcaagaaacatcagtatgagattaggaattgttggcca
cctgtattatctggggggatcagtccttgcattatcattgaaacaccccacaaagaaaca
ggaacaagcgacttctccagatttacaaattacagatttaaaaatcttttcattaatcct
tcacctttgcctgatttaagctggggatgttcacaggatgtttggctaaacatgttaaaa
aaagagaccagatatgttcatgacaaacattttgaagttctgcattctgaattggaacca
cagatgaggtcaatacttctagactggcttttagaggtgtgtgaagtatacacacttcat
agggaaacattttatcttgcgcaagacttttttgatagatttatgttgacacaaaaggat
ataaataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaactt
gaggaaatctacgctcctaagctgcaagagtttgcttatgtcactgatggtgcttgcagt
gaagaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgt
cctgtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaagatgct
cctaaagttcttctacctcagtattctcaggaaaagttcattcagatagctcagctttta
gatctgtgtattcttgccatcgattcattagagttccagtacagaatactcgctgctgct
gccttgtgccattttacctctcttgaagtggttaagaaagcctcaggtttggagtgggac
aacatttctgaatgtgtagactggatggtgccttttgtcagcatagtaaaaagtactagc
ccagtgaagctgaaggtttttaagaagatttctatggaagacagacaccatatacagaca
catacaaattacctggctatgctggatgaagtaaattatatgaacaccttcagaaagggg
ggacagttgtcaccagtttgcaatggaggcattatgacaccaccgaagagcactgaaaaa
ccaccaggaaaacactaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008660
Entry
103008660         CDS       T03086                                 

Gene name
CCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04110  Cell cycle
bacu04114  Oocyte meiosis
bacu04115  p53 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu04934  Cushing syndrome
bacu05161  Hepatitis B
bacu05162  Measles
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05206  MicroRNAs in cancer
bacu05215  Prostate cancer
bacu05222  Small cell lung cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103008660 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103008660 (CCNE1)
   04114 Oocyte meiosis
    103008660 (CCNE1)
   04115 p53 signaling pathway
    103008660 (CCNE1)
   04218 Cellular senescence
    103008660 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008660 (CCNE1)
   05206 MicroRNAs in cancer
    103008660 (CCNE1)
   05203 Viral carcinogenesis
    103008660 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103008660 (CCNE1)
   05215 Prostate cancer
    103008660 (CCNE1)
   05222 Small cell lung cancer
    103008660 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103008660 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103008660 (CCNE1)
   05161 Hepatitis B
    103008660 (CCNE1)
   05162 Measles
    103008660 (CCNE1)
   05169 Epstein-Barr virus infection
    103008660 (CCNE1)
   05165 Human papillomavirus infection
    103008660 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bacu03032]
    103008660 (CCNE1)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103008660 (CCNE1)
DNA replication proteins [BR:bacu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    103008660 (CCNE1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103008660 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C CBM_1
Other DBs
NCBI-GeneID: 103008660
NCBI-ProteinID: XP_007165093
UniProt: A0A383YQE7
LinkDB
Position
Un
AA seq 416 aa
MPREKKERDGKEPGTMKEESGTDVSVRSRKRKANVAVFLQDPDEEVAKIDRTVRSQCGSQ
PWDSNTVCENPCSLIPTPDKEEDELVYPNSAYKPQSCTPSRASPLPVLNWANREEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDFYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFSYGVLA
ASALYHFSSSELMQKVSGYQWCDIERCVKWMVPFAMVIRETGSSKMKHFRGVPLXXXXXA
EDAHNIQTHINSLDLLDKAQVKKAILSEENRISPLPTGVLTPPQSSKKQSSGQGTA
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgccgagggaaaagaaggagagggatgggaaggaacccggcaccatgaaagaggaaagc
ggcaccgatgtctctgttcgctccaggaaaaggaaggcaaatgtggccgtttttttgcag
gatccagatgaagaagttgccaaaattgacaggaccgtgagaagccagtgtggcagtcag
ccttgggacagtaatacagtctgtgaaaacccctgctccttgattcccacacctgacaaa
gaagaggatgagctcgtatacccaaattctgcatataagcctcagagttgcacaccatcc
agagcctcaccactgcctgtactgaactgggcaaatagagaggaagtatggaaaatcatg
ttaaacaaggaaaagacatacttgagggataagcactttatgcagcggcaccctcttctg
cagcctaaaatgcgagcgattcttctagattggttaatggaggtgtgtgaagtctataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatgttgtaaaaacgcttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcttatgttacagatggggct
tgttcaggagatgaaattcttaccatggaattaatcattatgaaggctcttaagtggcat
ttaagtcccctgaccattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gatttttatgaagtgctcctgccgcagtatcctcagcaaatcttcatacagattgcagag
cttttagatctctgtgtcctggatgtcggctgcttagaattttcttacggggtacttgct
gcttctgccttgtatcatttctcttcatctgaattgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaggtgtgtcaagtggatggttccatttgccatggttataagggaa
acaggaagttccaaaatgaagcacttcaggggagttcctctnnnnnnnnnnnnnnctgct
gaagatgcacacaacatccagacccatataaacagcttggatttgctggacaaagcccaa
gtaaagaaagccatattgtctgaagaaaataggatttctcctctccccactggggtcctc
actcccccacagagcagtaagaagcagagcagtgggcaaggaacagcatga

DBGET integrated database retrieval system