KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997603
Entry
102997603         CDS       T03086                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04024  cAMP signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04137  Mitophagy - animal
bacu04140  Autophagy - animal
bacu04141  Protein processing in endoplasmic reticulum
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04217  Necroptosis
bacu04310  Wnt signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04530  Tight junction
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04723  Retrograde endocannabinoid signaling
bacu04728  Dopaminergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04917  Prolactin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04926  Relaxin signaling pathway
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05231  Choline metabolism in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102997603 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102997603 (MAPK8)
   04012 ErbB signaling pathway
    102997603 (MAPK8)
   04014 Ras signaling pathway
    102997603 (MAPK8)
   04310 Wnt signaling pathway
    102997603 (MAPK8)
   04668 TNF signaling pathway
    102997603 (MAPK8)
   04068 FoxO signaling pathway
    102997603 (MAPK8)
   04071 Sphingolipid signaling pathway
    102997603 (MAPK8)
   04024 cAMP signaling pathway
    102997603 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102997603 (MAPK8)
   04137 Mitophagy - animal
    102997603 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    102997603 (MAPK8)
   04215 Apoptosis - multiple species
    102997603 (MAPK8)
   04217 Necroptosis
    102997603 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102997603 (MAPK8)
   04530 Tight junction
    102997603 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102997603 (MAPK8)
   04621 NOD-like receptor signaling pathway
    102997603 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    102997603 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    102997603 (MAPK8)
   04660 T cell receptor signaling pathway
    102997603 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    102997603 (MAPK8)
   04659 Th17 cell differentiation
    102997603 (MAPK8)
   04657 IL-17 signaling pathway
    102997603 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    102997603 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102997603 (MAPK8)
   04920 Adipocytokine signaling pathway
    102997603 (MAPK8)
   04912 GnRH signaling pathway
    102997603 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    102997603 (MAPK8)
   04917 Prolactin signaling pathway
    102997603 (MAPK8)
   04926 Relaxin signaling pathway
    102997603 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    102997603 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    102997603 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    102997603 (MAPK8)
   04722 Neurotrophin signaling pathway
    102997603 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102997603 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102997603 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997603 (MAPK8)
   05231 Choline metabolism in cancer
    102997603 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102997603 (MAPK8)
   05212 Pancreatic cancer
    102997603 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102997603 (MAPK8)
   05012 Parkinson disease
    102997603 (MAPK8)
   05016 Huntington disease
    102997603 (MAPK8)
   05017 Spinocerebellar ataxia
    102997603 (MAPK8)
   05020 Prion disease
    102997603 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    102997603 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102997603 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102997603 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    102997603 (MAPK8)
   04931 Insulin resistance
    102997603 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102997603 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102997603 (MAPK8)
   05135 Yersinia infection
    102997603 (MAPK8)
   05133 Pertussis
    102997603 (MAPK8)
   05152 Tuberculosis
    102997603 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102997603 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    102997603 (MAPK8)
   05161 Hepatitis B
    102997603 (MAPK8)
   05171 Coronavirus disease - COVID-19
    102997603 (MAPK8)
   05162 Measles
    102997603 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102997603 (MAPK8)
   05169 Epstein-Barr virus infection
    102997603 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102997603 (MAPK8)
   05142 Chagas disease
    102997603 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102997603 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    102997603 (MAPK8)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102997603 (MAPK8)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102997603 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 102997603
NCBI-ProteinID: XP_007178795
UniProt: A0A383ZUI6
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggttcaggagcccaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcaaactcatgctaagcgtgcttacagagagctagttcttatgaaatgtgta
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgtcaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtactgatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaattgatgcatctaaaaggatttctgtagatgaagctctccagcacccgtat
atcaacgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcaaccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007019
Entry
103007019         CDS       T03086                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04024  cAMP signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04137  Mitophagy - animal
bacu04140  Autophagy - animal
bacu04141  Protein processing in endoplasmic reticulum
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04217  Necroptosis
bacu04310  Wnt signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04530  Tight junction
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04723  Retrograde endocannabinoid signaling
bacu04728  Dopaminergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04917  Prolactin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04926  Relaxin signaling pathway
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05231  Choline metabolism in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103007019 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103007019 (MAPK9)
   04012 ErbB signaling pathway
    103007019 (MAPK9)
   04014 Ras signaling pathway
    103007019 (MAPK9)
   04310 Wnt signaling pathway
    103007019 (MAPK9)
   04668 TNF signaling pathway
    103007019 (MAPK9)
   04068 FoxO signaling pathway
    103007019 (MAPK9)
   04071 Sphingolipid signaling pathway
    103007019 (MAPK9)
   04024 cAMP signaling pathway
    103007019 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103007019 (MAPK9)
   04137 Mitophagy - animal
    103007019 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    103007019 (MAPK9)
   04215 Apoptosis - multiple species
    103007019 (MAPK9)
   04217 Necroptosis
    103007019 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103007019 (MAPK9)
   04530 Tight junction
    103007019 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103007019 (MAPK9)
   04621 NOD-like receptor signaling pathway
    103007019 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    103007019 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    103007019 (MAPK9)
   04660 T cell receptor signaling pathway
    103007019 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    103007019 (MAPK9)
   04659 Th17 cell differentiation
    103007019 (MAPK9)
   04657 IL-17 signaling pathway
    103007019 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    103007019 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103007019 (MAPK9)
   04920 Adipocytokine signaling pathway
    103007019 (MAPK9)
   04912 GnRH signaling pathway
    103007019 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    103007019 (MAPK9)
   04917 Prolactin signaling pathway
    103007019 (MAPK9)
   04926 Relaxin signaling pathway
    103007019 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    103007019 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    103007019 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    103007019 (MAPK9)
   04722 Neurotrophin signaling pathway
    103007019 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103007019 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103007019 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103007019 (MAPK9)
   05231 Choline metabolism in cancer
    103007019 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103007019 (MAPK9)
   05212 Pancreatic cancer
    103007019 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103007019 (MAPK9)
   05012 Parkinson disease
    103007019 (MAPK9)
   05016 Huntington disease
    103007019 (MAPK9)
   05017 Spinocerebellar ataxia
    103007019 (MAPK9)
   05020 Prion disease
    103007019 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    103007019 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103007019 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103007019 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    103007019 (MAPK9)
   04931 Insulin resistance
    103007019 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103007019 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103007019 (MAPK9)
   05135 Yersinia infection
    103007019 (MAPK9)
   05133 Pertussis
    103007019 (MAPK9)
   05152 Tuberculosis
    103007019 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103007019 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    103007019 (MAPK9)
   05161 Hepatitis B
    103007019 (MAPK9)
   05171 Coronavirus disease - COVID-19
    103007019 (MAPK9)
   05162 Measles
    103007019 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103007019 (MAPK9)
   05169 Epstein-Barr virus infection
    103007019 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103007019 (MAPK9)
   05142 Chagas disease
    103007019 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103007019 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103007019 (MAPK9)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103007019 (MAPK9)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103007019 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like RIO1 APH Kdo FTA2
Other DBs
NCBI-GeneID: 103007019
NCBI-ProteinID: XP_007169900
LinkDB
Position
Un
AA seq 445 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNYKQERKILESHHPQVTIINILIISLLNVFTPQKTLE
EFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVV
KSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELV
KGCVIFQGTDHIDQWNKVIEQLGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWI
FPSESERDKMKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYD
AQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSM
STEQTLASDTDSSLDASTGPLEGCR
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtacaagtggcagactcaactttc
actgtcctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaattgtc
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcagactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaattataaacaagaaagaaaaatccttgaatcccaccacccacaggtcact
atcattaacattttgataattagtttgttaaatgtgtttacaccacaaaaaactctagaa
gaatttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttatt
catatggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtatt
aaacatctacattcagctggtataattcatagagatttgaaacctagcaacattgtagta
aagtcagactgtacccttaagatccttgactttggcctggctcgcacagcatgcaccaac
tttatgatgaccccctacgtggtaacgcggtattatcgggcacctgaagtcatcctgggc
atgggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtg
aaaggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgag
cagctaggaacaccatctgcagatttcatgaagaaacttcagccaactgtgaggaattac
gtagaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggata
tttccatcagaatctgaacgagacaaaatgaaaacaagtcaagccagagacttactatca
aaaatgttagtgatagatcctgacaagcgaatctctgtagatgaagctttgcgtcaccct
tatatcactgtttggtatgaccctgctgaagcagaagcgccaccacctcaaatttatgat
gcccagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaa
gtaatggattgggaagaaagaagcaagaatggtgttgtgaaagatcaaccttcagatgca
gcagtaagtagcaacgccactccttctcagtcgtcatctatcaatgacatttcatccatg
tccactgagcagacgctggcctcagacacagacagcagtctggatgcctcaacaggaccc
cttgaaggttgtcgatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008728
Entry
103008728         CDS       T03086                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04024  cAMP signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04137  Mitophagy - animal
bacu04140  Autophagy - animal
bacu04141  Protein processing in endoplasmic reticulum
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04217  Necroptosis
bacu04310  Wnt signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04530  Tight junction
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04723  Retrograde endocannabinoid signaling
bacu04728  Dopaminergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04917  Prolactin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04926  Relaxin signaling pathway
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05231  Choline metabolism in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103008728 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103008728 (MAPK10)
   04012 ErbB signaling pathway
    103008728 (MAPK10)
   04014 Ras signaling pathway
    103008728 (MAPK10)
   04310 Wnt signaling pathway
    103008728 (MAPK10)
   04668 TNF signaling pathway
    103008728 (MAPK10)
   04068 FoxO signaling pathway
    103008728 (MAPK10)
   04071 Sphingolipid signaling pathway
    103008728 (MAPK10)
   04024 cAMP signaling pathway
    103008728 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103008728 (MAPK10)
   04137 Mitophagy - animal
    103008728 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    103008728 (MAPK10)
   04215 Apoptosis - multiple species
    103008728 (MAPK10)
   04217 Necroptosis
    103008728 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103008728 (MAPK10)
   04530 Tight junction
    103008728 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103008728 (MAPK10)
   04621 NOD-like receptor signaling pathway
    103008728 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    103008728 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    103008728 (MAPK10)
   04660 T cell receptor signaling pathway
    103008728 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    103008728 (MAPK10)
   04659 Th17 cell differentiation
    103008728 (MAPK10)
   04657 IL-17 signaling pathway
    103008728 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    103008728 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103008728 (MAPK10)
   04920 Adipocytokine signaling pathway
    103008728 (MAPK10)
   04912 GnRH signaling pathway
    103008728 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    103008728 (MAPK10)
   04917 Prolactin signaling pathway
    103008728 (MAPK10)
   04926 Relaxin signaling pathway
    103008728 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    103008728 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    103008728 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    103008728 (MAPK10)
   04722 Neurotrophin signaling pathway
    103008728 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103008728 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103008728 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008728 (MAPK10)
   05231 Choline metabolism in cancer
    103008728 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103008728 (MAPK10)
   05212 Pancreatic cancer
    103008728 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103008728 (MAPK10)
   05012 Parkinson disease
    103008728 (MAPK10)
   05016 Huntington disease
    103008728 (MAPK10)
   05017 Spinocerebellar ataxia
    103008728 (MAPK10)
   05020 Prion disease
    103008728 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    103008728 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103008728 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103008728 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    103008728 (MAPK10)
   04931 Insulin resistance
    103008728 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103008728 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103008728 (MAPK10)
   05135 Yersinia infection
    103008728 (MAPK10)
   05133 Pertussis
    103008728 (MAPK10)
   05152 Tuberculosis
    103008728 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103008728 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    103008728 (MAPK10)
   05161 Hepatitis B
    103008728 (MAPK10)
   05171 Coronavirus disease - COVID-19
    103008728 (MAPK10)
   05162 Measles
    103008728 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008728 (MAPK10)
   05169 Epstein-Barr virus infection
    103008728 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103008728 (MAPK10)
   05142 Chagas disease
    103008728 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103008728 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103008728 (MAPK10)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103008728 (MAPK10)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103008728 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 103008728
NCBI-ProteinID: XP_007177407
UniProt: A0A383ZQL2
LinkDB
Position
Un
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMSSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagcgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggag
ttagaccacgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggacttgaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctagactttggattggccaggacagcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagggcccctgaggttattctgggaatgggctac
aaggagaacgttgacatgtggtcagtagggtgcatcatgggagaaatgataaaaggtgca
gtgctgtttcctggcactgatcatattgaccagtggaacaaggtaattgagcaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggacgacgccttacagcatccgtacatcaat
gtgtggtatgatcccgctgaagtggaggcgcccccaccccagatatacgacaaacagctg
gatgaaagagaacacaccattgaagaatggaaagaacttatttacaaggaagtcatgagt
tcagaagaaaagactaagaatggcgttgtgaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaacgatatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system