KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997605
Entry
102997605         CDS       T03086                                 

Definition
(RefSeq) hepatocyte growth factor-like
  KO
K05460  hepatocyte growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04510  Focal adhesion
bacu05144  Malaria
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05211  Renal cell carcinoma
bacu05218  Melanoma
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102997605
   04014 Ras signaling pathway
    102997605
   04015 Rap1 signaling pathway
    102997605
   04020 Calcium signaling pathway
    102997605
   04151 PI3K-Akt signaling pathway
    102997605
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102997605
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997605
   05205 Proteoglycans in cancer
    102997605
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102997605
   05226 Gastric cancer
    102997605
   05218 Melanoma
    102997605
   05211 Renal cell carcinoma
    102997605
   05223 Non-small cell lung cancer
    102997605
  09174 Infectious disease: parasitic
   05144 Malaria
    102997605
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102997605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    102997605
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    102997605
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   102997605
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102997605
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 102997605
NCBI-ProteinID: XP_007179010
UniProt: A0A383ZV45
LinkDB
Position
Un
AA seq 730 aa
MWVTKLLPAVLLQHVLLHLLLLPTAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPM
ETTECIQGQGEGYRGIINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRN
KDLKDYEAWLGIHDVHGRGDEKRKQVLNVTQLVYGPEGSDLVLLKLARPAVLDDFVSTID
LPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEIC
AGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKVPQS
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttctgccagccgtactgctgcagcacgtcctcctccacctcctc
ctgcttcccactgccatcccctatgcagaaggacagaagaaaagaagaaacacacttcat
gaattcaaaaagtcagcaaagactactctaattaaagaagacccattactgaagataaaa
acaaaaaaaatgaacactgcagaccaatgtgccaatagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgacaaagcaagaaagcgatgcctctggttccct
ttcaatagcatgtcaagtggagtgaaaaaagagtttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcatcggtaaaggaggtagctataagggaacggta
tctatcactaaaagtggcatcaaatgccagccctggaattccatgataccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggaaagttatcga
ggccccatggatcacacagaatcaggcaagatttgtcagcgctgggatcatcagactcca
catcggcataaattcttgccagaaagatatcctgacaagggctttgatgataattattgc
cgcaatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccctgg
gagtactgtgcaattaaaatgtgcgctcacagtactatgaatgacacggatgtccctatg
gaaacaactgaatgcattcaaggtcaaggagaaggttaccggggcatcatcaataccatt
tggaatggaattccctgtcagcgttgggattcccagtatcctcaccagcatgacataact
cctgaaaatttcaagtgcaaggacctaagagaaaattattgccgaaatccagatggggct
gagtcaccgtggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgatgtgtcaagtggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaatttatccaaaacacgatctggactaacatgttcgatgtgggacaagaacatggaa
gatttacatcggcatatcttctgggaaccagatgctagtaagctgaataagaattactgc
cggaatcctgatgatgatgcccatggtccctggtgttacacggggaaccctctcattcct
tgggattactgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatccggtaatatcttgcgccaaaacaaaacaattgcgagttgtaaatggaattcca
acacgaacaaatgtaggatggatggttagtttgaaatacagaaataaacatatctgtgga
ggatcattgataaaggaaagttggattcttactgcaagacagtgtttcccttctcgaaac
aaagacttgaaagattatgaagcttggcttggaattcatgatgtccatggaagaggagat
gagaaacgcaaacaggttctaaatgttacccaactggtatatgggccggaaggatcagat
ctggtattactgaagcttgctaggcctgctgttctggatgattttgttagtacaattgat
ttacctaattatgggtgcacaattcctgaaaaaaccacttgcagtgtttatggctggggc
tacactggattgatcaactcggacggtctattacgagtagcacatctctatattatgggg
aatgagaaatgcagccaatatcatcaagggaaggtgactctgaatgagtctgaaatatgt
gctggggctgaaaatattgtatcaggaccatgcgagggagattatggtggcccactggtt
tgtgaacaacataaaatgagaatggttcttggtgtcatcgttcctggtcgtggatgtgcc
attccaaatcgtcctggtatttttgtccgagtggcatattatgcaaaatggatacacaaa
attatattaacgtataaggtaccacagtcgtag

DBGET integrated database retrieval system