KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997766
Entry
102997766         CDS       T03086                                 

Gene name
JAG2
Definition
(RefSeq) jagged 2
  KO
K21635  jagged-2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102997766 (JAG2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102997766 (JAG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997766 (JAG2)
  09162 Cancer: specific types
   05224 Breast cancer
    102997766 (JAG2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102997766 (JAG2)
SSDB
Motif
Pfam: EGF hEGF DSL EGF_2 EGF_CA NTP_transf_3
Other DBs
NCBI-GeneID: 102997766
NCBI-ProteinID: XP_007176333
UniProt: A0A383ZMK1
LinkDB
Position
Un
AA seq 894 aa
MINPEDRWKSLHFSGHVAHLELKIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKA
CMDGWMGKECKEAVCKQGCNLLHGGCSVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEP
WQCSCETNWGGLLCNKDLNYCGSHHPCTNGGTCINAEPDQYRCACPDGYSGKNCERAEHA
CASNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECTSNPCAAGGTCVDQVDGFECI
CPEQWGGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGANCHINVNDCGGQCQ
HGGTCKDLVNGYQCVCPRGFGGRHCERQLDECASSPCHVGLCEDLVDGFRCHCPQGFSGP
LCEVHTDFCQPSPCRDGARCYNLEGDYYCACPEDMGGKNCSEPRAPCPGGACRGGCSCVC
DSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCH
SRGRCYDLVNDFYCACDDGWKGKTSHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKG
STCTVAKNSSCLPNPCVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGVC
VDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRSGPRCQE
VIVFGRSCWSQGVPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGRKPCLLAGRPDTLSTQC
PPGQQCQEKAPGQCLQPPCMAWGECGAEEPWLPSTPCRPRSGHLDNSCARLTLHFNRDQV
PQGTTVGAVCSGIRALPATRAVARDRLLVLLCDRPSSEASAVEVAMSFSPARDLPDSSLI
QSAAHAIVAAITRRGNSSLLLAVTEVKVETVVMGSSSTEVPFLTALFSPGRRQY
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgatcaacccggaggaccgctggaagagcctgcatttcagcggccacgtggcacacctg
gagctgaagatccgtgtgcgctgcgacgagaactactacagcgccacctgcaacaagttc
tgccggccccgcaacgacttcttcggccactacacctgcgaccagtatggcaacaaggcc
tgcatggacggctggatgggcaaggagtgcaaggaggccgtgtgtaaacaaggatgtaac
ctgcttcacggggggtgctctgtgcctggggagtgcaggtgcagctacggctggcagggg
aggttttgtgacgagtgcgtcccgtacccgggctgcgtgcacggcagctgtgtcgagccc
tggcagtgtagctgcgagaccaactggggcggcctgctctgcaacaaagacctgaactac
tgcggcagccaccacccctgtaccaacgggggcacgtgcatcaacgcggagcccgaccag
taccgctgtgcctgccccgacggctactcgggcaagaactgcgagcgggccgagcatgcc
tgcgcctcgaacccgtgtgccaacgggggctcttgccacgaggtgccctcaggcttcgag
tgccactgcccatccggctggagcgggcccacctgtgcgcttgacattgacgagtgcacc
tccaacccgtgtgcggcagggggcacctgcgtggaccaggtggacggcttcgagtgcatc
tgtcccgagcagtgggggggggccacctgccagctggacgccaatgagtgcgaagggaag
ccgtgccttaatgctttttcttgcaaaaacctgattggtggctattactgtgattgcatc
ccgggctggaagggcgccaactgccacatcaacgtcaacgactgtgggggccagtgtcag
cacggcggcacctgcaaggacctggtgaacggctaccagtgcgtgtgcccacggggcttc
gggggccggcactgtgagcgccagctggacgaatgtgccagcagcccctgccacgtcggc
ctctgcgaggacctggtcgacggtttccgctgccactgcccccagggcttctcggggccg
ctctgcgaggtgcacaccgacttctgccagccaagcccctgccgggacggggcccgctgc
tacaacctggagggcgactactactgtgcgtgccccgaggacatgggtggcaagaactgc
tctgagccccgggcgccgtgccctggcggggcttgcagaggtggctgcagttgtgtctgt
gacagcggcttcacaggcacctactgccacgagaacatcgacgactgccttggccagccg
tgccgcaatgggggcacctgcatcgacgaggtggacgccttccgctgcttctgccccagc
ggctgggagggcgagctctgtgacaccaatcccaacgactgccttcccgatccctgccac
agccgcggccgttgctacgacctggtcaacgacttctattgcgcgtgtgacgatggttgg
aagggcaagaccagccactcgcgtgagttccagtgtgatgcctacacctgcagcaacggt
ggcacgtgctacgacagtggcgacaccttccgctgcgcctgccccccgggctggaagggc
agcacctgcaccgtcgccaagaacagcagctgcctgcccaacccctgcgtgaatgggggc
acctgtgtgggcagcggggactccttctcctgcatctgccgggatggctgggagggccgc
acctgcacacacaataccaacgactgcaatcctctgccttgctacaacggcggtgtctgc
gtggacggcgtcaactggttccgctgcgagtgtgcgccgggcttcgcgggccctgactgc
cgcatcaacattgacgagtgccagtcctcaccttgcgcctacggggccacgtgtgtggac
gagatcaacggctaccgctgcagttgccctcctggccggtctggcccgcggtgccaggag
gtgatcgtgttcgggaggtcctgctggtcacagggagtgcccttccctcacgggagctcc
tgggtggaggactgtaacagctgccgctgcctggacggccgccgggattgcagcaaggtg
tggtgcggccggaagccctgtctgctggctggccggcctgacaccctgagcacccagtgc
ccacctgggcagcagtgccaggagaaggccccgggccagtgcctgcagccgccctgcatg
gcctggggggagtgtggcgcggaggagccctggctgcccagcaccccttgccggccgcgc
tccggccacctggacaacagctgcgcccgcctcaccctgcacttcaaccgcgaccaggtg
ccccagggcaccaccgtgggcgccgtctgctcgggcatccgcgctctgcccgccacaagg
gcggtggcccgggaccgcctgctcgtgctgctctgtgaccggccgtcctcggaggccagc
gccgtggaggtggctatgtccttcagcccggcccgcgacctgcccgacagcagcctgatc
cagagtgcggcccatgccatcgtggcggccatcacccgacgggggaacagctcgctgctg
ctggctgtcaccgaggtcaaggtggagacggtcgtcatgggcagctcctccacagaagtg
cccttcctgactgctctgttctccccgggacggcggcagtattga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001492
Entry
103001492         CDS       T03086                                 

Gene name
JAG1
Definition
(RefSeq) jagged 1
  KO
K06052  jagged-1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04371  Apelin signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04668  TNF signaling pathway
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103001492 (JAG1)
   04371 Apelin signaling pathway
    103001492 (JAG1)
   04668 TNF signaling pathway
    103001492 (JAG1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103001492 (JAG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001492 (JAG1)
  09162 Cancer: specific types
   05224 Breast cancer
    103001492 (JAG1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103001492 (JAG1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103001492 (JAG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bacu04090]
    103001492 (JAG1)
CD molecules [BR:bacu04090]
 Proteins
  103001492 (JAG1)
SSDB
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3
Other DBs
NCBI-GeneID: 103001492
NCBI-ProteinID: XP_007165320
UniProt: A0A383YR28
LinkDB
Position
Un
AA seq 1218 aa
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCSRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFSLKASRGNERNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCETDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSGGWE
GAYCETNINDCSQNPCHNGGSCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGENWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRSCITVGSVIPDGAKWDDDCNTCQCLDGRIACSKVWCGPR
PCSLHKGHSECPSGQSCIPILDAQCFVRPCTGVGECRSSSLQPVKTKCASDPYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKREGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WVCCLVTAFYWCVRKRRKPGSHARSASEESTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFARQATYTLVDREEKSPHGTPAKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgcggtccccacggacgcgcggccggcccgggcgccccctgagcctcctgctcgccctg
ctctgcgccctgcgagccaaggtgtgcggggcctccggccagttcgagttggagatcctt
tccatgcagaacgtgaacggggagctgcaaaacgggaactgctgcggcggcgcccggaac
ccgggggaccgcaagtgctctcgcgacgagtgtgacacgtacttcaaagtgtgcctcaag
gagtaccagtcgcgcgtcacggccggggggccctgcagcttcggctcggggtccacgcct
gtcatcgggggcaacaccttcagcctcaaggccagtcgcggcaacgaacgcaaccgcatc
gtgctgcctttcagttttgcctggccgaggtcctacactttgcttgtggaggcgtgggat
tccagcaatgacactgtccaacccgacagcattattgaaaaggcttctcattcaggcatg
atcaaccccagccggcagtggcagacgctgaagcagaacacgggggttgcccactttgag
tatcagatccgcgtgacctgtgatgactattactatggcttcggctgcaataagttctgc
cgacccagagacgacttctttggccactatgcctgcgaccagaatggcaacaaaacttgc
atggaaggctggatgggccctgaatgtaacaaagctatctgccggcagggctgcagcccc
aagcatgggtcttgcaaactcccaggtgactgcaggtgccagtatggctggcagggcctg
tactgtgacaagtgcatcccacacccagggtgcgtccacggcacctgtaacgagccctgg
cagtgcctctgtgagactaactggggtggtcagctctgcgacaaagatctcaactactgc
gggacccaccagccgtgtctcaatgggggaacttgtagcaacacggggcctgacaaatat
cagtgttcatgccccgaggggtactcaggacccaactgtgaaattgcggaacacgcctgc
ctctctgatccctgccacaacagaggcagctgcaaggagacctccctggggtttgagtgt
gagtgttctccgggctggaccggccccacgtgctccacaaacattgatgactgttctcca
aataactgttcccacgggggcacctgccaggacttggttaacggatttaagtgcgtgtgc
ccgccccagtggacgggcaaaacgtgccagttagatgcaaatgaatgcgaggccaaacct
tgtgtaaatgccaaatcctgtaagaatctgattgccagctactactgtgattgcctcccg
ggctggatgggtcagaattgtgacataaatattaatgactgcctcggccaatgtcagaat
gacgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagacagacatcgatgagtgtgccagcaacccctgtctcaacgggggt
cactgtcagaacgaaatcaacagattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagctggacatcgattattgcgagcccaacccctgccagaatggtgcccagtgc
tacaaccgtgccagcgactatttctgcaagtgtcccgaggactatgaaggcaagaactgc
tcccaccttaaagaccactgccgcaccaccccctgtgaagtgattgacagctgcacggtg
gccatggcctccaatgacacgcctgaaggggtgcgctatatttcctccaatgtctgcggt
ccccacgggaagtgcaagagtcagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcactggaacgtactgccatgaaaatattaacgactgtgagagcaacccctgtaaaaat
ggtggcacttgcatcgatggtgtcaactcctacaagtgtatctgcagtggtggctgggag
ggcgcctactgtgagaccaatattaacgactgcagccagaacccctgccacaacgggggc
tcgtgtcgtgacctggtcaacgacttttactgcgactgtaaaaacgggtggaaaggcaag
acctgccactcacgtgacagccagtgtgacgaggctacgtgcaacaatggtggcacctgc
tatgacgagggggacgctttcaagtgcatgtgtcccggaggctgggaaggaacgacctgt
aacatagcccgaaacagtagctgcctgcctaacccctgccacaatgggggcacctgtgtg
gtcaacggcgagtccttcacgtgtgtctgcaaagaaggctgggaggggcccatctgtacg
cagaataccaatgactgcagtcctcatccctgctacaacagtggcacgtgcgtggatgga
gagaactggtaccgctgtgagtgcgcccccggcttcgctgggcccgactgcaggataaac
atcaacgaatgccagtcttcaccttgtgccttcggggcaacctgtgtggatgagatcaat
gggtaccggtgtgtctgccccccagggcacagtggtgctaaatgccaggaagtttcaggg
agatcttgcatcaccgtggggagcgtgatacctgatggggccaagtgggacgatgactgc
aacacctgccagtgcctggacgggaggatcgcctgctcgaaggtgtggtgtggtccccgc
ccttgctcgctgcacaaagggcacagcgagtgccccagcgggcagagctgcatccccatc
ctggacgcccagtgcttcgtgcgcccctgcactggtgtgggtgagtgccggtcctccagc
ctccagcccgtgaagaccaagtgtgcctccgacccctactaccaggacaactgtgccaac
atcacgttcaccttcaacaaggagatgatgtcgccgggtctcaccacagagcacatttgc
agcgaattgcggaatttgaatattttgaagaatgtttctgctgaatattcaatctacata
gcttgcgagccttccccttctgcaaacaatgaaatacacgtggccatttctgctgaagac
atccgggatgatggaaacccaatcaaggaaatcaccgacaaaattatagatcttgttagt
aaacgagaagggaacagctcactgatagccgccgttgcagaagtgagagttcagaggcgt
cctctgaagaacagaacagatttcctggtgcccctgctgagctcggtcctgaccgtggcc
tgggtctgctgcctggtgaccgccttctactggtgcgtgcgcaagcggcggaagcccggc
agccacgcgcgctcggcctctgaggagagcaccaccaacaacgtgcgggagcagctgaac
cagatcaagaaccccattgagaagcacggggccaacacggtccccatcaaggactacgag
aacaagaactccaaaatgtccaaaataaggacacacaactcggaggtggaagaggacgac
atggacaagcaccagcagaaagcccgcttcgccaggcaggccacgtacacactggtcgac
agagaggagaagtccccccacggcacgccggccaagcacccgaactggacaaacaaacag
gacaacagagacctggagagcgcgcagagcctgaaccgcatggagtacatcgtatag

DBGET integrated database retrieval system