KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997868
Entry
102997868         CDS       T03086                                 

Gene name
NOTCH1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04919  Thyroid hormone signaling pathway
bacu05020  Prion disease
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102997868 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102997868 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102997868 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997868 (NOTCH1)
   05206 MicroRNAs in cancer
    102997868 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    102997868 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion disease
    102997868 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102997868 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102997868 (NOTCH1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 Ank NODP DUF3454 Ank_5 NOD Notch Ank_4 Ank_3 EGF_3 cEGF
Other DBs
NCBI-GeneID: 102997868
NCBI-ProteinID: XP_007198510
LinkDB
Position
Un
AA seq 2270 aa
MPPCSGAFAGQRCQAPNPCLSAPCKNGGTCHTVERDGLVDYACRCRLGFSGPLCLTPRDH
ACLASPCLNGGTCDLLTLTEYKCLCPPGWSGKTCQQADPCASNPCANGGQCLPFEASYIC
GCPPGFHGPTCRQDVNECSQNPGLCHHGGTCHNEVGSYRCACRASHTGPRCELPYVPCSP
SPCQNGGTCRPTGDTAHECACLPGFTGQNCEANIDDCPGNNCKNGGACVDGVNTYNCRCP
PEWTGQHCTEDVDECQLMPNACQNGGTCHNAHGGYNCVCVNGWTGEDCSENIDDCASASC
FHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGY
TGPACSQDVDECSLGANPCEHAGKCINTLGSFECRCLQGYTGPRCEIDVNECVSNPCQND
ATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLQNGRCLDKINEFVCECPTGFTGHL
CQYDVDECASTPCRNGAKCLDGPNTYTCVCTEGYTGPHCEVDVDECDPDPCHYGSCKDGV
ATFTCLCRPGYTGHHCETNINECHSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDD
CASNPCDSGTCLDKIDGYECVCAPGYTGSMCHINIDECAGNPCHNGGTCEDGVNGFTCRC
PEGYHDPTCLSEVNECSSNPCIHGACRDSLNGYKCDCDPGWSGANCDINNNECESNPCVN
GGTCKDMTSGYVCACREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPLTGA
TCEVVLAPCAPGPCRNGGECKESKDYESFSCACPVGWQGQTCEIDINECVKSPCRAGASC
QNTNGGYLCQCQAGYTGRNCETDVDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEE
DINECASNPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINS
FTCLCPPGFTGSYCQHDVNECDSRPCLHGGTCHDSYGTYKCTCPQGYTGLNCQSLVRWCD
SSPCKNGGRCWQTNALYRCECHSGWTGLYCDVPSVSCEVAAWQQGINVTHLCRNGGLCMN
VGNTHHCHCQAGYTGSYCEDQVDECSPSPCQNGATCTDYPGGYSCECVAGYHGVNCSEEV
NECLSQPCRNGGTCIDLTNTYKCSCPRGTQGVHCEVNVDDCNPPVDPVSRGPKCFNNGTC
VDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNAFHCECRAGHTGRRC
ESVINGCKDRPCKNGGSCAVASNTARGFICKCPAGFEGATCENDARSCGSLRCLNGGTCI
SGPRSPACLCLGPFTGPECQFPVSSPCLGGNPCYNQGSCEPTSESPFYRCLCPAKFNGLL
CHILDYSFGGGVGLDIPPPQIEEACELPGCREEAGNKVCSLQCNNHACGWDGGDCSLNFN
DPWQNCTQALRCWKYFSNGRCDSQCNSAGCLFDGFDCQRAEGQCKXGPRGRPLCAAGAPG
LAGQHEGAVRSRAGGGXXXLVVLMPPEQLRNHSLHFLRELSRLLHTNVVFKRDASGQQMI
FPYYGREEELHKHPIRRSVAGGASLLPGSGGGRRRRELDPMDIRGSIVYLEIDNRQCVQS
SSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPPPLHFMYVAVVAFVLLF
FVGCGVLLSRKRRRQHGQLWFPEGFKVSKDTVTGIKILMFEEPVVLPDLDDQTDHRQWTQ
QHLDPTDLRVSAMAPTPPQGEADTDCMDVNVRGPDGYTPLMIASCSGGGLEMGNSEEEED
APAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPL
HAAVAADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVD
DLGKSALHWAAAVNNVEAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFA
NRDITDHMDRLPRDIAQERMHHDIVRLLDEYSLVRSPPLHGAPTLSPPLCSPGGYLGNLK
PAVQGKKARKPSTKGLACGGKEPKDLKARRKKSQDGKGCLLDSSSVLSPVDSLESPHGYL
SDVASPPLLPSPFQPSPSMPLSHLPGMPDAHLGVSHLSVAAKPEMAALSGGGRLAFEAGA
PPPPPPPPGPAPVSMARAPVSVARSPSPPPMTTAQFLTPPSQHSYSSPVDNTPSHQLQVP
QPPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTSMPSQIAHVPEAFK
NT seq 6813 nt   +upstreamnt  +downstreamnt
atgcctccctgcagcggggcctttgcgggccagcgatgccaggcgcccaacccctgcctc
agcgccccctgcaagaacggcgggacgtgtcacacggtggagcgcgacggcctggtggac
tacgcctgccgctgccgcctgggcttctcggggccgctgtgcctgacgccccgcgaccac
gcctgcctcgccagcccctgcctcaacggcggcacctgtgacctgctcactctcaccgag
tacaagtgcctctgccccccgggctggtcagggaagacatgccagcaggccgacccgtgc
gcctccaacccctgtgccaacggtggccagtgcctgcccttcgaggcctcgtacatctgc
ggctgcccgcccggcttccacggccccacctgcaggcaggacgtcaacgagtgcagccag
aaccccgggctctgccaccacggtggcacctgccacaatgaggtcggctcctaccgctgc
gcctgccgcgccagccacaccggcccccgctgcgagctgccctacgtgccctgcagccct
tccccctgccagaacgggggcacctgccgccccacgggggacaccgcccacgagtgcgcc
tgcctgccaggcttcaccggccagaactgcgaggcaaacattgacgactgtccaggaaac
aactgcaagaacggaggcgcctgcgtggacggcgtgaacacttacaactgccgctgcccc
ccggagtggacaggtcagcactgcaccgaggacgtggacgagtgccagctcatgcctaac
gcctgccagaatggcgggacctgccacaatgcccacggcggctacaactgcgtgtgcgtc
aacggctggacgggcgaggactgcagcgagaacatcgacgactgcgccagtgcctcctgc
ttccacggcgccacctgccacgaccgcgtggcctccttctactgcgagtgtccccacggc
cgcacgggtctgctgtgccacctcaatgacgcctgtatcagcaacccctgcaatgagggc
tccaactgcgacaccaaccccgtcaacggcaaggccatctgcacctgcccctcgggctac
acggggccggcctgcagccaggatgtggacgagtgctcgctgggcgccaacccctgtgag
cacgcgggcaagtgcatcaacacgctgggctccttcgagtgccggtgtctgcagggctac
accggcccgcgctgcgagatcgacgtcaacgagtgtgtgtcgaacccgtgtcagaacgac
gccacctgcctggaccagattggggagttccagtgtatctgcatgcccggctacgagggc
gtgcactgcgaggtgaacacggacgagtgtgccagcagcccgtgcctccagaatggccgc
tgcctggacaagatcaacgagttcgtgtgcgagtgtcccacaggcttcaccgggcacctg
tgccagtacgacgtggacgagtgtgcaagcacaccctgcaggaatggcgccaagtgtctg
gacgggcccaacacctacacctgcgtgtgcacggaaggctacacagggccccactgtgag
gtggacgttgacgagtgcgaccccgacccctgccactacgggtcctgcaaggacggcgtt
gccaccttcacctgcctgtgccggccgggctacacgggccaccactgcgagaccaacatc
aacgaatgccacagccagccctgccgccatgggggcacctgccaggaccgcgataatgcc
tacctctgcttctgcctcaaggggaccacaggacccaactgtgagattaacctggacgac
tgtgccagcaacccctgtgactcgggcacatgtctggataagattgacggctacgagtgt
gtgtgcgcgccgggctacacagggagcatgtgccacatcaacatcgacgagtgcgcgggc
aacccctgtcacaacggcggcacctgcgaggacggcgtcaacggcttcacctgccgctgc
cccgagggctaccacgaccccacctgcctgtccgaggtcaacgagtgcagcagcaacccc
tgcatccatggggcctgccgggacagcctcaacgggtacaagtgtgactgtgaccccggg
tggagtggggcaaactgtgacatcaacaacaacgagtgtgagtcgaacccctgtgtcaac
gggggcacctgcaaggacatgaccagcggctacgtgtgcgcctgccgggaaggcttcagt
ggccccaactgccagaccaacatcaacgagtgtgcgtccaacccgtgtctgaaccagggc
acgtgtatcgatgatgtggctgggtacaagtgcaactgcctcctgcccctcacaggagcc
acgtgcgaggtggtgctggccccgtgtgcccccggcccctgcagaaacggcggcgagtgc
aaggagtccaaggactacgagagcttctcctgcgcctgccccgtgggctggcaggggcag
acctgcgagattgacatcaacgagtgcgtgaagagcccgtgccgcgcgggagcctcctgc
cagaacaccaacggtggctacctctgccagtgccaggccggctacacggggcggaactgc
gagacggacgtcgatgactgccggcccaacccatgccacaacgggggctcctgcacagac
ggcatcaacacggccttctgcgactgcctgcccggcttccagggcgccttctgcgaggag
gacatcaacgagtgcgccagcaacccctgccgcaatggcgccaactgcaccgactgcgtg
gacagctacacctgcacctgccccgcgggcttcagtgggatccactgtgagaacaacacg
cctgactgcacggagagctcctgcttcaacggcggtacctgcgtggacggcatcaactcc
tttacctgcctgtgtccgccaggcttcacgggcagctactgccagcacgacgtcaatgag
tgcgactctcggccctgcctgcacggtggcacgtgccacgacagctatggcacctacaag
tgcacctgcccgcagggctacactggcctcaactgccagagcctcgtgcgctggtgtgac
tcctcgccctgcaagaatggcggcaggtgctggcagaccaacgccttgtaccgctgcgag
tgccacagcggctggactggcctctactgcgacgtgcccagcgtctcctgtgaggtggcc
gcctggcagcaaggcatcaatgttacccacctgtgccggaacggagggctctgcatgaat
gtgggcaacacgcaccactgccactgccaagcgggctacacgggcagctactgcgaggac
caggtagacgagtgctcgcccagcccctgccagaacggggccacttgcaccgactaccct
ggtggctactcctgcgagtgcgtggctggttaccacggggtgaactgctccgaggaggtc
aacgagtgtctgtcccagccgtgccggaacgggggcacctgcatcgacctcaccaacacc
tacaagtgctcctgcccccggggcacacagggcgtgcactgcgaggtcaacgtggacgac
tgcaacccccccgtcgaccccgtgtcccggggccccaagtgctttaacaacggcacctgc
gtggaccaggtgggcggctacagctgcacctgcccgcccggcttcgtgggcgagcgctgt
gagggtgatgtcaacgagtgcctgtccaacccgtgcgacgcccgcggcacccagaactgc
gtgcagcgcgtcaacgccttccactgcgagtgccgcgccggccacaccgggcgccgctgt
gagtcggtcatcaacggctgcaaggacaggccctgcaagaacgggggcagctgtgccgtg
gcctccaacaccgcccgcgggttcatctgcaaatgcccagcgggcttcgagggtgccacg
tgtgagaatgacgcacgcagctgcggcagcctgcgatgcctcaacggcggcacctgcatc
tcgggcccgcgcagccccgcctgcctgtgcctgggccccttcaccggccccgagtgccag
ttccctgtcagcagcccctgcctgggtggcaacccctgctacaaccagggcagctgcgag
cccacgtccgagagccccttctaccgctgcctgtgccccgccaagttcaacgggctcctg
tgccatatcctggactacagcttcggcggaggcgtgggcctcgacatccccccgccgcag
atcgaggaggcctgcgagctccccggctgccgcgaggaggccggcaacaaggtctgcagc
ctgcagtgcaacaaccacgcctgcggctgggacggcggcgactgctccctcaacttcaac
gacccctggcagaactgcacgcaggccctgcggtgctggaagtacttcagcaacggccgc
tgcgacagccagtgcaactcggccggctgcctcttcgacggcttcgactgccagcgcgca
gaaggccagtgcaagtaaggcccgcggggacggccgctctgcgccgcgggggccccgggg
ctcgcggggcagcacgagggagccgtccgctcacgggcagggggaggnnnnnnnnngctg
gtggtgctgatgccgcccgagcagctgcgcaaccactccctgcacttcctgcgcgagctc
agccgcctgctgcacacgaacgtggtcttcaagcgcgacgccagcggccagcagatgatc
ttcccctactacggccgcgaggaggagctgcacaagcaccccatcaggcgctctgtggcc
ggcggggcctcgctgctcccaggcagcgggggcgggcgccgacgcagggagctggacccc
atggacatccgcgggtccatcgtctacctggagatcgacaaccggcagtgcgtgcagtca
tcctcccagtgcttccagagcgccacggacgtggccgcctttctgggcgcgcttgcctcg
ctgggcagcctcaacatcccgtacaagatcgaggccgtgcagagtgagacggtggagccg
cccccgcccccgccgctgcacttcatgtacgtggccgtggtggccttcgtgctgctcttc
ttcgtgggctgcggggtgctgctgtcgcggaagcgccggcggcagcatggccagctctgg
ttccccgagggcttcaaggtgtcaaaagacactgtcactggaataaagattttaatgttc
gaggagcccgtggtcctccccgacctggatgaccagacagaccaccggcagtggacccag
cagcacctggaccccactgacctccgcgtgtccgccatggcccccacgccgccccagggc
gaggccgacactgactgcatggacgtcaacgtccgcgggccggacggctacacgcccctc
atgatagcctcctgcagtggagggggcctggagatgggcaacagcgaggaggaggaggac
gcacccgcggtcatctcggacttcatctaccagggcgccagcctgcacaaccagacggac
cgcaccggcgagaccgccctgcacctggcggcccgctactcgcgctctgacgcggccaaa
cggctgctggaggccagcgctgacgccaacatccaggacaacatgggccgcaccccgctg
cacgcggccgtggctgccgacgcgcagggtgtctttcagatcctgatccggaaccgagcc
acggacctggacgcccgcatgcacgacggcacaactccactgatcctggccgcccgcctg
gccgtcgagggcatgctggaggacctcatcaactcccacgccgacgtcaacgctgtggac
gacctgggcaagtccgccctgcactgggccgccgcagtgaacaacgtggaggccgccgtc
gtgctcctgaagaacggggccaacaaggacatgcagaacaacaaggaggagacgcccttg
ttcctggccgcccgggagggcagctacgagacggccaaggtactgctggaccatttcgcc
aaccgggacatcacggaccacatggaccgcctgccccgcgacatcgcgcaggagcgcatg
caccacgacatcgtgcggctgctggacgagtacagcctggtgcgcagccccccgctgcac
ggcgcgcccaccctgtcgcccccgctctgctctcccggcggctacctgggcaacctcaag
cccgccgtgcagggcaagaaggcccgcaagcccagcaccaagggcctggcctgcggcggc
aaggagcccaaggacctcaaggcgcggaggaagaagtcccaggacggcaagggctgcttg
ctggacagctcgagcgtgctgtcgcccgtggactccctggagtccccccacggctacctg
tcggacgtggcctccccgcccctcctgccctcccctttccagccgtctccctctatgccc
ctcagccacctgcccgggatgcccgacgcccacctgggcgtcagccacctgagcgtggcg
gccaagcccgagatggcagcgctgagtgggggcggccggctggccttcgaggcgggggcg
cccccgcccccccccccccccccggggcccgcccccgtctccatggcccgcgcccccgtc
tccgtggcccgctccccgtctcccccgcccatgaccaccgcccagttcctgacgcccccc
tcccagcacagctactcctcccccgtggacaacacccccagccaccagctgcaggtgccc
cagccccccttcctcaccccgtccccagagtcccccgaccagtggtccagctcatcgcca
cactccaacatctccgactggtccgagggcatctccagcccgcccaccagcatgccgtcc
cagatcgcccacgttcctgaggcctttaagtaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008998
Entry
103008998         CDS       T03086                                 

Gene name
NOTCH4
Definition
(RefSeq) notch 4
  KO
K20996  Notch 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103008998 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103008998 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008998 (NOTCH4)
   05206 MicroRNAs in cancer
    103008998 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    103008998 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103008998 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103008998 (NOTCH4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_5 Ank_2 Notch Ank Ank_3 Ank_4 EGF_2 NODP NOD cEGF
Other DBs
NCBI-GeneID: 103008998
NCBI-ProteinID: XP_007193953
UniProt: A0A384B325
LinkDB
Position
Un
AA seq 1992 aa
MQPPSLLLPLLLLLCRSVVQTRGLQCGSFPEPCANGGTCLSLSQGQGTCQCAPGFLGETC
QFPDPCQDAQLCQNGGSCQALLPTLPSSPSLPSPLAPSFFCTCPSGFTGDRCQAQLKDPC
ASFCSKMGRCHIQASGRPQCSCMPGWTGEHCQLRDFCSANPCVNGGVCLATYPQIQCRCP
PGFEGHACERDVNECFLDPGPCPKGTSCHNTLGSFQCLCPAGWGGPRCELRPGPCPPRGC
PSGGTCQVVPGRDSTFHLCLCPPGFTGPSCEVNPDDCVGHQCQNGGTCQDGLGTYTCLCP
EAWTGWDCSEDVDECEVQGLPRCRNGGTCQNSAGGFHCVCVSGWGGTGCEENLDDCVAAT
CAPGSTCIDRVGSFSCLCPPGRTGLLCHMEDMCLSQPCHQEAQCNTNPLRGSTFCVCQPG
YTGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFECLCPPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFQCLCPPGLEGQLCEVETDECASAPCLNEADCQDLLNGFRCVCRPGF
TGSRCEEDINECRSSPCANGGQCQDQPGSFHCKCLPGFEGPRCQAEVDECLSGPCPTGAS
CLDLPGAFLCLCPSGFTGHLCEIPLCAPNLCQPKQRCQDPEEEAHCLCPSGSPGCAPAED
NCTCHHGHCQRSSCVCDVGWTGPECDTELGGCVSTPCAHGGTCHPQPFGYNCTCATGYTG
PTCSEELTACHSGPCLNGGSCSPSPEGYSCTCPPSHTGLRCQTSIDHCASAPCLHGGTCV
NRPSASSCLCTTGFQGPRCEGRIRPSCADSPCRNRATCQDGPQGPRCLCPPGYTGGSCQT
LMDSCAQKPCPHNSHCLQTGPSFQCLCLQGWTGPLCNLPLSSCQKAALSQGTEVSSLCQN
GGICIDSGPSHFCHCPPGFQGSICQERVNPCESRPCQHGATCVAQPNGYLCQCTPGYSGQ
NCSKEPDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAAC
HSLANAFYCQCLPGHTGQRCEVELDPCQSQPCSHGGSCEATAGPPPGFTCHCPQGFEGPT
CSHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLNGYGGPDCLTPPAPPGCGPPSPCLHN
GSCSETPGLGGPGFRCSCPPSSPGPRCQRPGAKGCEGRSGDGACDAGCSGPGGNWDGGDC
SLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCRDHF
HNGHCEKGCNTAECGWDGGDCRPEDGDSEWGPSLALLVVLSPSTLDQQLLALARVLSLTL
RVGLWVRKDSDGRNMVYPYPGAQAEEELGGTPDPSHHERAAPQTQPTGKETDSLSTGFVV
VMDVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHPRAGTEPPAN
QLPWPVLCSPVAGVLLLALGALLVLQLIRRKRREHGALWLPPGFTRRSQTQPVPRRRRPP
LGEDSIGLKALKPEAEVDEDGVVMCSGPKEGEEADQVEEMASPSKCQLWPLSSDCQELPQ
AAMLTPPQDSEMDVPDVDTRGPDGVTPLMSAVCCGGVESRTYQETWLGSPEPWEPLLGGG
ACPQVHTVGTGETPLHLAARFSRPTAARRLLEAGADPNQPDRAGRTPLHTAVAADAREVC
QLLLRSRQTAVDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAA
VNNARAARSLLQAGADKDALDGREQTPLFLAAREGAMEVAQLLLGLGAARGLRDQAGLAP
GDIARQRNHWDLLTLLEGVGPPEARHKATPGRGAGALQRARTASGSVPPRGGGAQPRCRT
LSAGAYPQARTLSVDLAAHGGGAYSHCRSLSKGAGEGPPLRGRRFSAGMRGPPSNPAIVR
GRSGVAAGSGGVASAVDWPCDWVALGACGPASNTPIPPPCLTPSPERGSPQVAWGPPAHQ
VIPLSAGGEGQK
NT seq 5979 nt   +upstreamnt  +downstreamnt
atgcagcccccttcactgctgctgccgctgctgctgctgctgtgtcggtcagtcgtccag
accagagggctgcagtgcgggagtttcccagaaccctgtgccaacggaggcacctgcctg
agcctatctcaggggcaagggacctgccagtgtgcccctggcttcctgggtgagacatgc
cagtttccagacccctgccaggatgcccagctctgccagaatggaggcagctgtcaagcc
ctgcttcccacccttcccagctcccccagccttccctctcccttggcccccagcttcttc
tgcacctgcccctctggcttcactggtgacaggtgccaggcccagctcaaggacccctgt
gcttccttctgttccaaaatgggccgctgccacatccaggcctcgggccgcccacagtgc
tcctgcatgccgggatggacaggtgagcactgccagctccgggacttctgctcagccaac
ccctgcgtcaacggaggggtgtgtctggccacatacccccagatccagtgccgctgccca
cctggcttcgagggccatgcctgcgaacgcgatgtcaacgagtgtttcctggacccagga
ccctgccccaagggcacctcctgccacaacaccctggggtccttccagtgcctctgcccc
gctgggtgggggggtccacgctgtgagctccggccaggaccctgcccccccaggggctgt
cccagtgggggcacctgtcaagtggttccagggagagactccaccttccacctctgcctg
tgtcccccaggtttcacaggcccaagctgtgaggtgaatccagatgactgtgtcgggcac
cagtgtcagaacggaggcacctgtcaggatgggctgggcacctacacctgcctctgccca
gaggcctggacaggctgggattgctctgaagatgtggacgaatgtgaggttcagggtctc
cctcgctgcagaaacgggggtacctgccagaactcagctggcggcttccattgtgtgtgt
gtgagtggctggggaggcacgggctgcgaggagaacctggacgactgtgttgccgccacc
tgtgccccaggatccacctgcatcgaccgtgtgggctccttctcctgcctctgcccacct
ggccgcacaggcctcctgtgccacatggaggacatgtgtctgagccagccgtgccaccag
gaagcccagtgcaacaccaaccccctgaggggctccacattctgcgtgtgtcagcctggc
tacacggggcccacttgccaccaggacctggacgagtgtcagatggcccagcaaggcccc
agtccctgtgaacatggcggctcctgcctcaacacgcccggctcctttgagtgcctctgt
ccccctggctacacgggatcccgctgcgaggccgatcacaatgagtgcctgtcgcagccc
tgccaccctggcagcacctgcctggacttgctcgccaccttccagtgcctctgcccacca
ggcttagaagggcagctctgtgaggtagagacagacgagtgcgcctctgccccttgcctg
aacgaggctgactgccaagacctgctcaatggcttccggtgcgtctgccggcccggattc
accggctcccggtgtgaggaggacatcaacgagtgcagaagctctccctgtgccaacggt
gggcagtgccaggaccagcctggatccttccattgcaagtgtctcccaggctttgaaggc
ccacgctgtcaggcggaggtggacgagtgtctgagtggcccatgccccactggagccagc
tgccttgacctcccaggagctttcctttgcctctgcccatctggcttcacaggtcatctc
tgtgaaattcccctgtgtgcccccaacctgtgccagcccaagcaaagatgccaggatccg
gaggaagaggcccactgcctctgccccagtggaagccctggctgtgccccagctgaagac
aactgcacctgccaccatgggcactgccagagatcctcgtgtgtgtgtgatgtgggttgg
acaggaccagagtgtgacacagagctggggggttgcgtctccacaccctgtgcccacgga
gggacctgccacccccagccctttggctacaactgcacctgcgccacaggttacacaggg
cccacttgcagcgaggagctgacagcttgtcactcagggccctgtctcaacggtggttcc
tgtagccccagccctgaaggctactcctgcacctgccctccgagccacaccgggctccgc
tgccagaccagcattgaccactgtgcctctgcaccgtgcctccacgggggcacctgtgtg
aacaggcccagcgcctcctcctgcctctgcaccacgggcttccagggcccacgctgcgag
ggaaggatccgtcccagctgtgcggacagcccctgtaggaacagggcaacctgccaagat
ggccctcagggtccccgctgcctctgtccccctggctacacaggaggcagctgccagacg
ctgatggactcatgcgctcagaagccctgtccacacaattcccactgcctccagactggg
ccctccttccagtgcctgtgcctccagggatggaccggacctctctgcaacctgccgctg
tcctcctgccagaaggctgctctgagccaaggcacagaagtctcttccctgtgccagaat
ggaggcatctgcatcgacagcggcccctcccatttctgccactgtccccctggattccaa
ggcagtatatgccaggagagggtgaacccctgtgagtccaggccctgccagcacggggcc
acctgcgtggcccaacctaatggttatctctgccagtgtacaccaggctacagtggacag
aactgctcaaaggaacctgacgcttgtcaatcccagccctgtcacaaccatggaacgtgc
acccccaaacctggaggcttccactgtgcctgccctccaggctttgtggggctgcgctgt
gagggggatgtagatgagtgtctggaccagccctgtcaccccacaggcactgcagcctgc
cactctctggccaatgccttctactgccagtgtctgcctggacacacaggccagcggtgt
gaagtggagctagacccctgccagagccagccctgctcccatggagggtcttgtgaggcc
acagcaggaccacccccaggattcacctgccactgcccccagggttttgaaggccccacc
tgcagccacagagccccctcctgcggtctccatcactgccaccacggcggcctatgtctg
ccctcccccaagcctggattcccaccccgctgtgcctgcctcaatggctatgggggccct
gactgcctaaccccacccgctcctccaggctgtggccctccttctccatgcctacacaat
ggcagctgctcagagacccctgggctggggggcccaggctttcgatgctcctgccctccc
agctctccagggccccggtgtcagaggcctggagcaaagggatgtgagggcagaagtgga
gatggggcctgcgacgctggctgcagcggcccaggaggaaattgggatggtggggactgc
tccctgggggtcccagacccctggaagggctgcccctcccattctcggtgctggcttctc
ttccgggatgggcagtgccatccgcaatgtgactctgaagagtgtttgtttgatggctat
gactgtgagactcctccagcctgcactccagcctatgaccagtactgccgtgatcacttc
cacaatggacactgtgagaagggctgcaacactgcagaatgtggctgggatgggggcgac
tgcaggcccgaagatggggattcggagtgggggccctccctagccctgctggtggtgctg
agcccctcaaccctggaccagcagctgcttgccctggcccgggtgctgtccctgactctg
agggtagggctttgggtaaggaaggatagtgatggcaggaacatggtgtacccctatcct
ggagcccaggccgaagaggagctaggaggaaccccagacccctctcaccatgagagagca
gcccctcaaacacagcctacaggcaaggagacggactccctcagcactgggtttgtggtg
gtgatggatgtggacttgtcccgctgtggccccgaccatcctgcatcccgctgtccctgg
gaccctgggctcctgctccgcttccttgctgcgatggccgcagtgggggccctggagccc
ctactgccaggacccctgctggctgcccaccctcgtgcaggcaccgagccccccgccaac
cagcttccctggcctgtactgtgctcgccggtggccggggtgcttctcctggccctcggg
gctcttctcgtcctccagctcatccgccggaagcgccgagagcatggggccctctggctg
ccccctgggttcactcgaaggtctcagactcagccagttccccgccgacgccggcccccc
ctgggcgaggacagtatcggcctcaaggcactgaaaccagaggcagaagttgatgaggat
ggagttgtgatgtgctcaggccccaaggaaggagaagaggcggaccaggttgaagaaatg
gcctcaccctccaagtgccagctctggcctctgagtagtgactgtcaggagctcccccag
gcagccatgctgactcctccccaggactctgagatggatgtccctgatgtggacacccgt
ggacctgatggggtgacacccctgatgtcagcagtctgctgtgggggagtggagtccagg
acctatcaggagacatggttgggaagccctgagccctgggaacctctgctgggtggaggg
gcctgtccccaggttcacaccgtgggcactggggagacccccctgcacctggctgctcga
ttctcccggccaaccgctgcccgccgcctccttgaggcaggagccgaccccaaccagcca
gaccgggcagggcgcaccccccttcacaccgctgtggctgctgatgctcgggaggtttgc
cagctcttactccgcagcagacagactgcagtagatgcgcggacagaggatgggaccaca
gccctgatgctggccgccaggctagctgttgaggacctggttgaagaactgattgcagcc
caagcagatgtgggggccagagacaaatggggaaaaaccgcgctgcactgggccgccgcc
gtgaacaacgcccgggccgcccgctcccttctccaggccggagccgataaagacgcactg
gacggcagggagcagacgccgctgttcctggcggcccgagaaggagccatggaggtagcc
cagctgctgctggggctgggagccgcccgagggctgcgggaccaagccgggctagcgccc
ggggacatcgcccgccagcgcaaccactgggatctgctgacgctgctggaaggggtggga
ccaccggaggctcgtcacaaagccacgccgggccgcggcgccggcgccttgcagcgcgcg
cggaccgcatcaggaagcgtgcccccgcgtgggggcggggctcagccgcgctgccggacg
ctgtcagccggagcctatcctcaagcccggactttgtccgtagacttggccgcccatggg
ggcggggcctattcgcactgccgaagcctatcgaaaggagcaggagaaggcccgcccctc
cgcggccgtaggttttctgcaggcatgcgcgggcctccgtccaaccctgcaatagtgcga
ggaagatccggggtcgcggccgggagcgggggtgtggcctcagctgttgactggccctgc
gattgggtggctctaggagcctgcggtcccgcctccaacactccaatcccgcctccttgc
cttactccgtcccctgagcggggatcccctcaagttgcatggggtcccccagcccaccaa
gtaatacccttaagtgcgggaggcgagggtcagaaataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013129
Entry
103013129         CDS       T03086                                 

Gene name
NOTCH3
Definition
(RefSeq) notch 3
  KO
K20995  Notch 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04371  Apelin signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04919  Thyroid hormone signaling pathway
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103013129 (NOTCH3)
   04371 Apelin signaling pathway
    103013129 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103013129 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103013129 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013129 (NOTCH3)
   05206 MicroRNAs in cancer
    103013129 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    103013129 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103013129 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103013129 (NOTCH3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 EGF_2 Notch Ank Ank_5 NODP NOD DUF3454 Ank_3 Ank_4 FXa_inhibition cEGF EGF_3
Other DBs
NCBI-GeneID: 103013129
NCBI-ProteinID: XP_007173570
UniProt: A0A383ZEF4
LinkDB
Position
Un
AA seq 2257 aa
MGPGPRGRRRRRLMSPPPPLPSVRTLPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPSR
EAACLCPPGWVGERCQLEDPCHSGPCAGHGVCQSSVVAGTARFSCRCPRGFRGPDCSLPD
PCLSSPCAHGARCSVGSDGRYACSCPPGYQGRSCRSDVDECRVGGPCRHGGTCLNTPGSF
RCQCPAGYTGPLCESPSVACAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCP
GHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCV
CVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCH
EDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGR
GYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDECQSSPCVNG
GVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTV
CEHNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLV
DKYLCRCPPGTTGVNCEVNIDDCASNPCTFGICRDSINRYDCVCQPGFTGPLCNVEINEC
ASSPCGEGGSCVDGENGFQCLCPPGSLPPLCLPPSHPCAQEPCSHGVCHDAPGGFRCVCE
LGWSGPQCSQSLARDACESHPCWAGGTCTSDGTGFRCTCPPGVQGRQCELLSPCTPNPCE
HGGYCESAPGQLAVCSCPPGWQGSRCQQDVDECAGPSPCGPHGTCTNLAGSFSCTCHEGY
SGPSCDQDIDDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGSRCARDVDECLSSPCGPGTC
TDHVASFTCTCPPGYGGFLCEQDLADCSPSSCFNGGTCVDGVNSFSCLCRLGYTGAHCQH
EADPCLSRPCLHGGVCTASHPGFRCACPEGFTGAQCQTLVDWCSRTPCQNGGHCARTGAS
FYCLCAPGWSGRLCDIQSLPCREAAAQIGVPMEQLCQAGGQCVDKDSSHYCVCPEGHTGS
HCEREVDPCLAQPCQHGGTCRGYMGGYVCECPAGYTSDNCEEDMDECASQPCQHGGVCID
LVARYLCSCPPGTLGVLCEINEDDCGPGPPLDPGPRCLHNGTCVDLVGGFRCTCPPGYTG
LRCEADINECRPGACHAAHTRDCLQDPGGGFHCLCHAGFTGPHCQTVLSACESQPCQHGG
QCHPSPGSGGALTFSCHCVPPFWGPRCERVARSCWELQCPVGVPCQQTVRGPRCACPPGL
SGPACRGSRGSPLGAANASCVTSPCLHGGSCRPETLAPFFRCACAPGWAGPRCEIPAAVP
EAPEEPSCPRAACEAKSGDKRCDRECNSPGCGWDGGDCSLSVSDPWRQCAALQCWLLFNN
SRCDPACSSPACLYDNFDCRAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLD
CAGEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSGILRTSLRFRLDENGQAMVFPYH
RPGPGSESRNRRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVER
LDFPYPLRAARGEPLELPEPSVPLLPLLAASAVFLLVILVLGVMVARRKREHSTLWFPEG
FALHKDAAAGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGV
GAEDAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFC
GGALEAIPAEEDEAEDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLL
DAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVE
GMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLA
AREGSFEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGL
GPLLCPPGAFLPGLKVAQSGGKKSRRPPGKAGLGPQGARGRGKKLTLACPGPLAESSVTL
SPVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGERPPPYLAAPGHGDEFP
AAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATGATAA
GTLSAQPLPLSVPGPLAQSQTQLGSQPEVTPKRQVLA
NT seq 6774 nt   +upstreamnt  +downstreamnt
atggggccggggccccggggccgccgccgccgtcgcctgatgtcgccgccgccacccctg
ccgtccgtgcggacgctgcccttattgctactgctagcggggccgggggctgcagcgccc
ccttgcctggatggaagcccgtgtgcgaatggaggtcgctgcacccagctgccctcccgg
gaggctgcctgcctgtgcccaccaggctgggtgggtgaacggtgtcagctggaagacccc
tgccattccggcccctgtgctggccatggtgtctgccagagctcggtggtggcaggcacc
gcccggttctcctgccgctgcccccgtggcttccgaggcccggactgctccctgccagac
ccctgcctcagcagcccctgtgcccatggtgcccgctgctcggtggggtccgatggccgc
tacgcctgctcctgcccacctggctaccagggccgcagctgccgaagcgatgtggatgag
tgccgggtgggcgggccctgccgccacggtggcacctgtctcaacacgcctggctccttc
cgctgccagtgcccagctggctacacagggccactgtgtgagagcccctcggtggcctgt
gctccctcgccatgccgtaacgggggcacctgtagacagagtggcgacctcacctacgac
tgtgcctgccttcctgggttcgagggccagaactgtgaagtgaatgtggacgactgtcca
gggcaccgatgtctaaatggggggacgtgtgtggacggtgtcaacacctacaactgccag
tgccctcctgagtggacaggccaattctgtacggaggacgtggacgagtgtcagctgcag
cccaacgcttgccacaatgggggcacttgcttcaacacactgggtggccacagctgtgtg
tgtgtcaatggctggacaggcgagagctgcagtcagaatattgatgactgtgccacggcc
gtgtgcttccatggggccacctgccatgaccgtgtggcctccttctactgtgcttgcccc
atgggcaaaactggacttctgtgtcatctggatgacgcctgcgtcagtaacccctgtcac
gaggatgctatctgcgacacgaacccggtgaacggcagggctatctgcacctgtccacct
ggcttcacaggcggggcttgtgaccaggatgtggatgagtgttccatcggtgccaaccct
tgtgagcacctgggccggtgcgtgaacacacagggctcattcctgtgccagtgcggccgt
ggctacactggtccgcgttgcgagaccgacgtcaatgagtgcctctctggcccctgccgc
aaccaggccacgtgcctcgaccgtataggccagtttacctgcatctgcatggcaggcttc
acaggcacttattgcgaggtggacatggacgagtgtcagagcagcccgtgtgtcaatggc
ggggtctgcaaggacagagtcaatggcttcagctgcacctgcccctcgggcttcagcggg
gctatgtgtcagctcgacgtggatgaatgcgccagcacaccctgccggaatggagccaag
tgcgtggaccagccggatggctatgagtgccgctgcgcagagggcttcgagggcacggtg
tgtgagcacaacgtggatgactgctcgccagacccatgccaccatgggcgctgtgtggat
ggcatcgccagtttctcgtgcgcctgtgccccgggctacaccggcacgcgctgtgaaagc
caggtggacgagtgccgaagccagccctgccgccacggtggcaaatgcctagacctggtg
gacaaatacctctgccgctgccctcccggcaccacaggtgtgaactgtgaggtgaacatt
gatgattgtgctagcaacccctgcacctttggaatctgccgggacagcatcaaccgctat
gactgtgtctgccagcctggcttcacagggcctctctgcaacgtggagatcaacgagtgt
gcgtccagcccatgcggtgaggggggctcctgcgtggatggtgaaaatggcttccaatgc
ctctgcccacctggctccctgcccccgctctgtcttcccccaagccatccctgcgcccaa
gaaccctgcagtcatggcgtctgccacgacgcgcctggagggttccgctgcgtgtgtgag
cttggctggagtggccctcagtgcagtcagagcctcgctcgagatgcctgtgaatcccat
ccctgctgggcaggcggcacctgcaccagtgatggaacgggcttccgctgtacctgtccc
cctggtgtccagggccgtcagtgtgagctgctgtccccctgcaccccaaatccctgtgag
catgggggctactgtgagtctgcccctggccagctggctgtctgctcctgcccccctggt
tggcaaggctcacgatgtcagcaggacgtggatgagtgtgctggcccctcaccctgtggt
ccccatggtacctgcaccaacctggcagggagtttcagctgtacctgccacgagggctat
agtggcccttcctgtgatcaggacatcgatgactgtgaccccaacccctgcctgaatggt
ggctcatgtcaggatggagtgggctccttttcctgctcctgcctacctggctttgctggc
tcccgctgcgcccgagatgtggatgagtgtctgagcagcccctgcggcccaggcacctgc
acagaccacgtggcttccttcacctgcacctgcccgccgggttatggaggcttcctctgt
gagcaggacctagctgactgcagccccagctcctgcttcaatggcgggacctgcgtggat
ggtgtgaactccttcagctgcctgtgccgcctgggctacactggcgcacactgccaacat
gaggccgacccttgcctctcgagaccctgcttgcacgggggcgtctgcactgcctcccac
cccggcttccgctgtgcctgccctgaaggcttcacaggcgcgcagtgccagacgctggta
gactggtgcagccgcacgccttgtcagaatgggggccactgtgcccggaccggggcctct
ttctactgcctttgcgccccggggtggagcggccgcctctgtgacatccagagtctaccc
tgcagagaggccgcagcccaaatcggggtgccgatggagcagctgtgtcaggctggtggg
cagtgcgtggacaaggacagctcccactactgcgtgtgcccagagggccacacaggcagt
cattgtgagcgggaggtggacccctgcttggcccagccctgccagcatgggggcacctgc
cgaggctacatgggaggttatgtgtgcgagtgtccagctggctacactagtgacaactgt
gaggaagacatggacgagtgtgcctcccagccctgccagcatgggggcgtctgcattgac
cttgtggcccgctatctctgctcgtgtcctccaggaacgctgggcgtgctctgcgagatt
aatgaggatgactgtggcccaggcccacccctggacccgggcccccggtgtctgcacaat
ggtacctgtgtggacctggtgggtggcttccgctgcacctgtcccccgggatacaccggc
ctgcgctgtgaggcggacatcaatgagtgtcgtccaggtgcctgccatgcggcacatacc
cgggactgcctgcaggacccaggtgggggcttccactgcctttgtcatgccggcttcaca
ggtccccactgtcagactgtcttgtctgcctgtgagtcgcagccatgccagcatggaggc
cagtgccatcccagccccggctctgggggagcgctgactttctcttgccactgtgtcccg
ccgttctggggcccgcgttgtgagcgggtggcacgttcctgctgggagctgcagtgcccg
gtgggcgtcccgtgccagcagacggtccgtggaccgcgctgcgcctgtcccccggggctg
tcgggtcccgcctgccggggttcccgggggtcgccactgggagccgccaatgccagctgc
gtgacctccccctgcctccacgggggctcctgccgcccggagacgctggcgcccttcttc
cgctgcgcgtgcgcgccaggctgggctgggccgcgctgtgagatacctgcagcggtgccc
gaggcccccgaggagccgtcttgcccgagagccgcctgcgaggccaaaagcggcgacaag
cgatgtgaccgagagtgcaacagcccaggctgcggctgggacggcggcgactgctcgctg
agcgtgagcgacccctggcggcagtgcgcggcgttgcagtgctggctcctcttcaacaac
agccgctgcgaccccgcctgcagttcgcccgcctgcctctatgacaacttcgactgccgc
gcaggcggccgggagcgcacctgcaacccggtgtatgagaagtactgcgcggaccacttt
gccgacggccgctgcgatcagggctgcaacacagaggagtgcggttgggatggactggac
tgtgcgggtgaggtgccagctctgctggcccgaggcgtcctggtgctcaccgtgctgctg
ccgccggaggagctgctgcgctccagcgccgacttcctgcagcggctcagcggcatcctg
cgcacctcgttgcgcttccgtctggacgagaacggccaggctatggtcttcccttaccac
cggcctggtcctggctccgaatcccggaaccggcgggagctggcccctgaggtgatcggc
tctgtggtgatgctggagattgacaaccgtctgtgcctgcagtcacctgagaatgaccac
tgttttcccgacgcccagagcgcggcggactacctgggagcgttgtcagcggtggagcgc
cttgatttcccgtacccactgcgggctgcacggggggaaccgctggagctgccggagcca
agcgtgccgctactgcccctgctggctgcgagcgccgtcttcctgctggtcatcctcgtc
ctgggcgtcatggtggcccgccgcaagcgtgagcacagcaccctctggttccccgagggt
ttcgcgctgcacaaggatgctgcagctggccacaagggccggcgggaacccgtgggccaa
gacgctctgggcatgaagaacatggccaagggtgagagcctgatgggagaggtggccaca
gactggatggacacagagtgcccggaggccaagcgactgaaggtcgaggagcctggtgtg
ggagctgaggatgctgtggattgccgccagtggactcagcaccacctggttgctgccgac
atccgtgtggcaccagccatggcattgacgccaccacagggcgatgcagatgctgatggc
atggatgtcaacgtgcgtggtccagatggcttcaccccgctaatgctggcctccttctgt
gggggggccctggaagcaatcccagctgaggaggacgaggcagaagacacgtcagccagc
atcatctcagaccttatctgccagggggcgcagcttggggctcggaccgaccgcacgggt
gagacggccctgcacctggctgcccgctatgcccgggctgatgcggccaagcggctgctg
gatgctggggcagacaccaatgcccaggaccactcaggccgcacccccctgcacacagcc
gtcactgctgatgcccagggcgttttccagattctcatccggaaccgctccacagacctg
gatgcccgcatggcagacggctccacagcactgatcctggcggcccgcctggcagtggaa
ggcatggtggaagagctcatcgccagccatgctgatgtcaatgctgtggatgaactcgga
aaatcagccttacactgggctgcagctgtcaacaacgtggaggccaccttggccctgctc
aaaaatggagctaacaaagacatgcaagatagcaaggaggagactccgctgttcctggcc
gccagggagggcagctttgaggctgccaagctgctgctggaccactttgccaaccgtgag
atcacagaccacctggacaggctgccccgggatgtggcccaggagcggctgcaccaggac
atcgtgcgcttgctagaccagcccagtgggccccgtagcccccctggcccccacggcctg
gggcccttgctctgcccgcccggggccttcctcccaggcctcaaggtggcacagtccggg
ggcaagaagagccggaggcctcctgggaaggcagggctggggcctcagggcgcccggggg
cggggcaagaagttgaccctggcctgcccggggcccttggccgagagctccgtcacgctc
tcgcccgtggactcgctggactccccacggccctttggtggcccccccgcgtcccctggc
ggcttccccctcgaggggccctacgcggctgccacggccacagccgtgtctctcgcgcag
cttggtggcgagcggcccccaccgtacctggcagccccaggacatggcgatgagttcccc
gcggccggggcccacagcagccccccaaaggcccgcttcctgcgggtccccagcgagcac
ccttacctgaccccttccccagagtcccccgagcactgggccagcccctcacctccctca
ctctcagactggtccgactccacgcccagcccggccactgccaccggggccacggccgct
gggacactgtctgcccagccgcttcccctgtcagtccctggccctcttgctcagtcccag
acccagctagggtcccagcctgaagtcacccccaagaggcaagtgttggcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014791
Entry
103014791         CDS       T03086                                 

Gene name
NOTCH2
Definition
(RefSeq) notch 2
  KO
K20994  Notch 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04919  Thyroid hormone signaling pathway
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103014791 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103014791 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103014791 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014791 (NOTCH2)
   05206 MicroRNAs in cancer
    103014791 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    103014791 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103014791 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103014791 (NOTCH2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch NOD Ank Ank_5 Ank_2 NODP Ank_3 Ank_4 EGF_3 cEGF
Other DBs
NCBI-GeneID: 103014791
NCBI-ProteinID: XP_007169363
LinkDB
Position
Un
AA seq 2044 aa
MPALRPAPLWALLALWLCRAAPARALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCAARAMLGKATCRCAPGFTGEDCQYSTTHPCFVSHPCLNGGT
CHVLSRDTYECTCQVGFTGKLCQWTDTCLSQPCANGSTCTTVANQFSCTCLAGFTGQKCA
SDVNECDVPGQCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGVTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGGDCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCKNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECHSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASSPCVHGVCM
DGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCVHGNCTGGLSGYKCLCDAGWVGINCEVDRNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCLVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAGVCKEAPNFESYTCLCAPGWQGQRCTVDIDECVSKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDVDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDRCQTDMDECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVYCENNIDECTESSCFNGGTCIDGINSFSCLCPVGFTGP
FCLHEINECNSHPCLNEGVCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCIQ
EKAQSRCLCPSGWAGAYCDVPNVSCEVAASHRGVPVDRLCQHSGICISAGNSHHCQCPLG
YTGSYCEDQLDECSSNPCQHGASCRDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPRCFCPNPQDCDSGCAS
SPCQHGGSCYPQRQPPYYSCKCSPPFWGSHCEFYTAPTSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINSQCDELCNTAECLFDNFECQRNG
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADRPENLADGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDAQGDLMVYPYYGEKSAAMKKQRLTRRSLPGDQEQEVAG
SQVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPKRTQLIY
LLAVAVVIVLFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKVGRTYLHGSLWTPHICTSPSSRSSPSSSKCQ
PLIQ
NT seq 6135 nt   +upstreamnt  +downstreamnt
atgcccgccctgcgccccgctccgctgtgggcgctgctggcactgtggctgtgccgcgcg
gcccccgcgcgtgcattgcaatgtcgggacggctatgagccctgtgtaaatgaaggaata
tgtgttacctaccacaatggtacagggtactgcaaatgcccagagggattcttgggagaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacgtgtgcg
gcccgtgctatgttggggaaagccacatgccgatgtgccccaggcttcacaggcgaggac
tgccagtactcgaccactcacccctgctttgtgtctcacccttgcctgaatggaggcacc
tgccatgtgcttagccgggatacctatgagtgcacctgccaagttggttttacaggtaaa
ctgtgccaatggactgatacctgtctgtctcagccctgtgcaaatggaagtacctgtacc
actgtggccaaccagttctcctgcacatgcctcgccggcttcacagggcagaagtgtgcg
agtgatgtcaatgagtgtgacgttccaggacagtgccagcacggtggcacctgcctcaac
ctcccgggttcctaccagtgccagtgcccccagggcttcacaggccagcactgtgacagt
ccctacgtgccctgtgcaccctccccctgtgtcaatggaggcacctgccggcagactggt
gacttcacctttgagtgcaactgccttccaggttttgaaggggtcacctgtgagcggaat
attgatgactgtcctaatcacaagtgtcagaatggaggggtttgtgtggatggggtcaac
acttacaactgccgctgcccccctcagtggacaggacagttctgcacagaggatgtggat
gagtgcctgctgcaacccaatgcctgtcagaacgggggcacctgtaccaaccgcaatggg
ggctatggctgtgtgtgtgttaatggttggagtggagatgactgcagtgagaacattgac
gactgcgccttcgcctcctgcactccaggctccacctgcattgatcgtgtggcctccttc
tcttgcatgtgcccagaaggaaaggcaggtctcttatgtcatctggatgatgcatgcatc
agcaacccctgccacaagggggcactgtgtgataccaaccctctgaatgggcagtatatt
tgcacctgtccacaaggctacaaagggggtgactgtacagaagatgtggatgagtgtgcc
atggccaatagcaatccttgtgagcatgcgggaaagtgtgtgaacacagatggtgccttc
cactgtgagtgtctgaagggctatgcagggcctcgttgcgagatggacatcaacgagtgc
cattcagacccctgcaagaatgatgccacctgtctggataagattggaggcttcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgcgaactggagataaatgaatgtcagagc
aacccttgcgtgaacaatggacagtgtgtggataaagtcaatcgcttccagtgtctgtgt
ccgcctggtttcactgggccagtttgccagatcgatattgacgactgttccagtacccca
tgtctgaacggggcaaagtgtatagatcacccaaatggttatgaatgccagtgtgccaca
ggattcactggtgtgttgtgtgaggagaacatcgacaactgtgaccctgatccttgccac
cacggccagtgtcaggatgggattgactcctacacctgcatctgcaatccagggtacatg
ggcgccatctgcagcgaccagatagatgaatgtcacagcagcccttgcttgaatgagggt
cgctgcatcgacctggtaaatggttaccagtgcaactgccagccaggcacatcaggtgtt
aattgtgaaatcaattttgatgactgtgcaagtagcccttgtgtccacggagtctgtatg
gatggcgttaatcgttatagctgcgtctgctcaccaggattcacagggcagagatgtaac
attgacattgatgagtgtgcctccaatccctgtcgcaagggtgcaacatgtatcaacgat
gtgaacggtttccgctgtatatgccctgaggggccccatcatcccagctgctactcacag
gtgaacgagtgcctgagcaatccctgtgtccatggaaactgtactgggggcctcagtgga
tacaagtgcctctgtgatgcaggctgggttggcatcaactgtgaagtggacagaaatgaa
tgcctttctaatccatgccagaacggaggaacttgtgacaatctggtgaatggatacagg
tgcacttgcaagaagggctttaaaggctataactgtctggtgaatattgatgaatgtgct
tcgaatccatgtctgaaccaaggaacctgctttgatgatataagtggttatacctgccac
tgtgtgctgccatacacaggcaagaactgtcagactgtattagctccctgttccccaaac
ccttgtgagaatgctggtgtttgcaaagaggcaccaaattttgagagttacacctgcctg
tgtgctcctggctggcaaggtcagcggtgtacagttgacattgatgagtgtgtctccaag
ccctgcatgaaccacggtctctgccataacacccagggcagctacatgtgcgagtgtcct
ccaggcttcagtggtatggactgtgaggaggacgtcgatgactgccttgccaatccttgc
cagaatggaggttcctgtgtagacggagtgaatactttctcctgcctgtgccttccgggc
ttcactggggacaggtgtcagacagacatggatgagtgtctgagtgaaccctgtaagaac
ggagggacctgctctgactacgtcaacagttacacctgcaagtgccaggcgggatttgat
ggagtctactgtgagaacaacattgacgagtgcactgagagctcctgtttcaacggtggc
acatgtatcgatgggattaactccttctcttgcttgtgccctgtgggcttcactggcccc
ttctgcctccacgagatcaatgaatgcaactctcatccatgcctgaatgaaggagtatgt
gttgatggcctgggtacctaccgctgcatctgcccattgggctacactgggaaaaactgt
cagaccctggtgaacctctgtagtcggtctccatgtaaaaacaaagggacttgcattcag
gaaaaagcacagtcccggtgcctgtgtccatctggatgggctggtgcttactgtgacgtg
cccaatgtctcctgtgaggtggcggcctcccacagaggggtgcccgttgaccgcttgtgc
cagcactcaggcatctgcatcagtgccggcaactcgcatcactgccagtgccccctgggc
tacaccgggagctactgtgaggatcagcttgatgagtgctcgtccaatccctgccagcac
ggagccagctgcagggacttcatcggtggatacagatgtgagtgtgtcccaggatatcag
ggtgtcaattgcgagtatgaagtggatgagtgccagaaccagccatgccagaatggaggc
acctgtatcgaccttgtgaaccatttcaagtgctcctgcccaccaggcactcggggcctg
ctttgtgaagagaacattgatgactgtgccaggggtccccactgccttaatggcggtcag
tgtgtggataggattgggggctacagttgtcgctgcttgcctggctttgctggagagcgg
tgtgagggggacatcaacgagtgcctctccaacccctgcagctctgagggcagcctagac
tgcatacagcttaccaacgactacctgtgtgtctgccgcagtgcctttaccggtcgtcac
tgtgaaactttcgtcgatgtgtgtccccagatgccttgcctgaatggagggacctgtgct
gtggccagcaacatgcctgatggtttcatctgtcgttgtcccccgggattctctggggcg
agatgccagagcagctgtggacaagtgaagtgtaggagaggggagcagtgtgtgcacaca
gcctcaggaccccgctgcttctgccccaacccccaggactgcgactcaggctgtgccagt
agcccctgccagcacgggggcagctgctacccgcagcgccagcctccttattactcttgc
aagtgttctccgccgttctggggcagccactgtgaattctacacagctcccaccagcacc
cctcctgccacctgtctgagccagtattgtgccgacaaagctcgggatggcgtctgcgat
gaggcctgcaacagccatgcctgccagtgggatgggggtgactgttccctcaccatggag
aacccctgggccaactgctcctccccgcttccctgctgggattacatcaacagccagtgc
gatgagctgtgcaacacggccgagtgcctgttcgacaactttgagtgccagaggaatggc
aagacgtgcaaatatgacaagtactgtgcagaccacttcaaagacaaccattgtgaccag
ggatgcaacagtgaggagtgtggctgggatgggctggactgtgctgctgaccggccagaa
aacctggcagacggcaccctggtaattgtggtgctgatgccacctgaacagctgctccag
gatgcccgcagcttcttgcgggcgctgggcaccctgctccacaccaacctacgcatcaaa
cgggatgcccagggggacctcatggtctacccctattatggtgagaagtcagctgccatg
aagaagcagagactgacgcgcaggtcccttcctggcgatcaagaacaggaagtggctggc
tctcaggtattcctggaaattgacaaccgccagtgtgttcaagattcagaccagtgcttc
aagaatacggatgctgcagcagctcttctggcgtctcacgccatccaggggaccctgtcg
taccctcttgtgtctgttgtcagtgaatccctgaccccaaaacgcacccagcttatctat
ctacttgctgttgctgttgttattgtcttgtttattatcctgctgggggttatcatggca
aaacgaaagcgtaagcatggctccctctggctgcctgaaggcttcacccttcgccgtgac
tccagcaatcacaaacgtcgtgagccagtgggacaggatgccgtggggctgaaaaatctc
tcagtgcaagtctcagaggctaacctaattggttctggaacaagtgaacattgggtcgac
gatgaagggccccagccaaagaaagccaaggctgaagatgaggctttactctcagaagaa
gatgatcccatcgatcggcggccatggacacagcagcaccttgaagctgcagatatccgt
aggacgccatcgttggctctcactcctccgcaggcagagcaggaggtggatgtgctggat
gtgaacgtccgcggcccagatgggtgcaccccactgatgctggcttctctccgaggaggc
agctcagatatgagtgatgaagatgaagatgcggaggactcttccgccaacatcatcacg
gacttggtctaccagggtgccagcctccaagcccagacagaccggactggtgagatggcc
ctgcaccttgcagcccgctactcgagggccgatgctgccaagcgcctcctggatgcaggt
gcagatgccaacgcccaggacaacatgggccgctgccctctccatgctgcagtagcagct
gatgcccaaggtgtcttccagatactgatccgcaaccgagtaactgatctagatgccagg
atgaatgatggcactacacccctgatcctggctgcccgcctagctgtggagggaatggtg
gcagagttgatcaactgccaagcagatgtgaatgcagtggacgaccacggaaaatctgct
cttcactgggcagctgctgtgaataatgtggaggcgacccttttgctgttgaaaaatggg
gccaaccgagacatgcaggacaacaaggtggggagaacctatctacatggatcactatgg
accccacacatctgcacttctccgtcatcccgttccagcccctcttcctcaaagtgtcag
cctctgatccagtag

DBGET integrated database retrieval system