KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997874
Entry
102997874         CDS       T03086                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04064  NF-kappa B signaling pathway
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04668  TNF signaling pathway
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102997874 (TRAF3)
   04668 TNF signaling pathway
    102997874 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102997874 (TRAF3)
   04621 NOD-like receptor signaling pathway
    102997874 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    102997874 (TRAF3)
   04657 IL-17 signaling pathway
    102997874 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997874 (TRAF3)
   05203 Viral carcinogenesis
    102997874 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102997874 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102997874 (TRAF3)
   05160 Hepatitis C
    102997874 (TRAF3)
   05171 Coronavirus disease - COVID-19
    102997874 (TRAF3)
   05164 Influenza A
    102997874 (TRAF3)
   05162 Measles
    102997874 (TRAF3)
   05168 Herpes simplex virus 1 infection
    102997874 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102997874 (TRAF3)
   05169 Epstein-Barr virus infection
    102997874 (TRAF3)
   05165 Human papillomavirus infection
    102997874 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Spc7 zf-C3HC4_2 MPS2 zf-RING_4 Spc29 FliJ zf-RING_5 Cast Tropomyosin_1 Crescentin KxDL GAS Fib_alpha DUF3450 DUF1664 ADIP T3SSipB SPATA24 Exonuc_VII_L LMBR1
Other DBs
NCBI-GeneID: 102997874
NCBI-ProteinID: XP_007176250
UniProt: A0A383ZMB7
LinkDB
Position
Un
AA seq 572 aa
MTHRMEPSKKLDAAGTLPANPPLKLHPDRGAGPAVLVPEQGGYKERFVKAVEDKYKCEKC
RLVLCNPKQTECGHRFCETCMGTLLSSSSPKCTACREGISKDKVFKDNCCKREILALQIY
CRNEGRGCVEQLALGHLLVHLKNDCQFEELLCVRADCKEKVLRKDLRDHVDKACKYREAT
CSHCKSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKR
YGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQIC
SFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQSWEEAGSMKSSVES
LQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNG
VLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFV
IMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPV
FVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgacacacaggatggagccgagtaaaaagctggacgcagccggcaccctgccagccaac
cccccactgaagctgcaccctgaccgcggcgctgggcctgccgtcctggtccccgagcag
gggggctacaaggagcgcttcgtgaaggccgtggaggacaagtacaagtgcgagaagtgc
cgcctggtgctctgcaaccccaagcagaccgagtgcggacaccgcttctgcgagacctgc
atgggcaccctgctcagctcctccagcccgaaatgcactgcgtgtcgagaaggcatcagc
aaagacaaggtgtttaaggataattgctgcaagagagagattctggcccttcagatatac
tgtaggaacgaaggcagaggctgtgtagagcagttagcactggggcacctgctggtgcat
ttgaagaatgattgccagtttgaggagctcttgtgtgtccgtgccgactgcaaagagaag
gtactgaggaaggacctgcgtgaccacgtggacaaggcctgtaaataccgtgaggccacg
tgcagccactgcaaaagccaggtcccgatgatcacgttgcagaaacacgaagacaccgag
tgtccctgcgtggtggtgtcctgccctcataagtgcagtgtccagacccttctgaggagc
gagttgagtgcacacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgc
tatggctgcgtttttcaggggacaaaccagcagattaaggcccacgaggccagctccgcg
gtgcagcatgtcaacttactcaaagaatggagcaactctctagagaaaaaggtttccttg
ctgcagaatgaaagtgtagaaaaaaacaagagcatacagagtttgcacaaccagatatgt
agctttgaaattgaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaata
cttcatttacagcgagtaatagacagccaagcagagaaactgaaggagcttgacaaagag
atccgccccttccggcagagctgggaggaagcaggcagcatgaagagcagcgtggagtcc
ctccagaaccgggtgaccgagctggagagcgtggacaaaagcgccggccaggcggctcgg
aacacaggcctgctggagtcccagctgagccggcacgaccagatgctcagtgtccacgac
atccgcctggccgacatggacctgcggttccaggtcctggagaccgccagctacaacggc
gtgctgatctggaagatccgggattacaagcggcggaagcaggaggccgtcatggggaag
accctgtccctctacagccagcctttctacaccggctatttcggctacaagatgtgcgcc
agggtctacctgaacggggatggcatgggcaaggggacgcacctgtcgctgttttttgtc
atcatgcgtggagaatacgatgctctgcttccctggccattcaagcagaaggtgacgctc
atgctgatggaccaggggtcctcccggcgacacttgggggacgctttcaagccggacccc
aacagcagcagcttcaagaagcccaccggcgagatgaacatcgcttccggctgcccagtc
ttcgtggcccagactgtgctggaaaacgggacgtatattaaagatgacaccattttcatc
aaagtcatagtggatacttcggacctgcctgacccctga

DBGET integrated database retrieval system