KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997907
Entry
102997907         CDS       T03086                                 

Gene name
TPR
Definition
(RefSeq) translocated promoter region, nuclear basket protein
  KO
K09291  nucleoprotein TPR
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03013  RNA transport
bacu05014  Amyotrophic lateral sclerosis
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102997907 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997907 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    102997907 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102997907 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bacu03019]
    102997907 (TPR)
Messenger RNA biogenesis [BR:bacu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     102997907 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 TFIIA Seryl_tRNA_N
Other DBs
NCBI-GeneID: 102997907
NCBI-ProteinID: XP_007167034
UniProt: A0A383YWH9
LinkDB
Position
Un
AA seq 2361 aa
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKR
LSHSQERLVNETRECQSLRLELEKLNSQLKALTEKNKELEVAQDRNIAIQSQFTRTKEEL
EAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNATKGELQLKLDELQASEVSVKYRE
KRLEQEKELLHNQNTWLNTELKTKTDELLALGRDKGNEILELKCNLENKKEEVSRMEEQM
NGLKTSNENLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS
NELTRAVDELHKLLKEAGEANKAIQDHLLEVEESKDQMEKEMLEKIGKLEKELENANDLL
SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKHSS
VLERDNQRMEVQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
RNIEELQQQNQRLLVALRELGETREREEQEATSSKITEIHLKLESALVEVEQLRESRRHQ
MQLVDSIVRQRDMYRILLSQTTGVTIPLQASSLDDSSLMSTPKRSSTSQAVSTPTPVPVI
ESAEAIEAKAALKQLQEIFENYRKEKADNEKMQNEQLEKLQEQVTDLRSQNTKISTQLDF
ASKRYEMLQDNVEGYRREITSLHERNQKLTAATQKQEQIINTMTQDLRGANEKLAVAEVR
AENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ
IEKLEHEISHLKKKLENEVELRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKE
IATLKQHLSNVEVQLASQSSQRTGKGQPSNKEDVDDLLSQLRQAEEQVNELKERLKTSTN
NVEQYRAMVTSLEESLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQD
DKRKAIESMEQQLSELKKTLSSVQSEVQEALQRASTALTNEQQARRDCQEQAKIAVEAQN
KYERELMLHAADVEALQAAKEQVSKMMSVRQHLEETAQKAESQLLECKASWEERERMLKD
EVSKSVSRCEDLEKQNRLLHDQIEKLSDKVVASMKEGVQGPLNVSLSEEGKSSEQILEIL
RFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE
ELMKKTETMNVVMETNKILREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGM
LQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHAKRIQQLTEEIGRLKA
EIARSNASLTNNQNLIQSLKEDLNKVRTEKESIQKDLDAKIIDIQEKVKTITQVKKIGRR
YKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENL
QKALSEKEVEARSLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAA
KSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRMTALKSQYEGRISRLERELREH
QERHLEQRDEPQEPTNKVPEQQRQITLKTAPTSGERGIASTSDPPTANIKPTPVVSTPSK
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPV
FGSTSGSVRSTSPNVQPSIPQPILTVQQQTQATAFVQPTQQSHPQIEPTNQELSPNIVEV
VQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQISDDTVEMPLPKKLK
SVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDL
GPLQSDQQTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDYEEDEEEDDDDEDDTGM
GDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGESNQRAADSQNSGEGN
TGTAESSFSQEISREQQPSSASERQTPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQRI
QMTRRQSVGRGLQLTPGIGGMQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAGVP
RFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAAPV
TVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAGLE
IDSQQEEEPVQASDESDLPSTSQDPPSSSSADTSSSQPKPFRRVRLQTTLRQGVRGRQFN
RQRGVSHAMGGRGGINRGNIN
NT seq 7086 nt   +upstreamnt  +downstreamnt
atggcggcggtgttgcagcaagtcctggagcgcacagaactgaacaagctgcctaagtcg
gtccagaacaaacttgagaagttccttgctgaccagcagtccgagatcgatggcctcaag
gggcggcacgagaaatttaaggtggagagcgaacaacagtactttgagatagagaagagg
ctgtcccacagtcaggagagacttgtgaatgaaacccgagagtgccaaagcttgcggctt
gagctggagaaactcaacagtcaactgaaggcgctaactgagaaaaacaaagaacttgaa
gtggctcaggatcgcaatattgccattcagagccagtttacaaggacaaaggaagaatta
gaagctgagaaaagagacttaattagaaccaatgagagactatctcaagaacttgaatat
ttaacagaggatgttaaacgtctaaatgaaaaacttaaagaaagcaatgcaacaaagggt
gagcttcagttaaaattggatgaacttcaagcttctgaggtttctgttaagtatcgagaa
aaacgcttggagcaagaaaaagagttgttacataatcagaatacttggctgaatacagag
ttgaagaccaaaactgatgaacttctggctctcggcagagataaaggaaatgaaattctc
gagcttaaatgtaatcttgaaaacaaaaaagaggaggtttctagaatggaagaacagatg
aatggcttgaaaacatcaaatgagaatcttcaaaagcatgtagaggatttgttgacgaaa
ctgaaagaggccaaggaacagcaggccagtatggaagagaaattccacaatgaattaaat
gctcacataaaactctctaacctttacaagagtgctgctgatgattcagaggcaaagagc
aatgaactgacccgagcagtggatgaattacacaaacttttgaaggaagctggagaagcc
aataaagcaatacaagatcatcttctagaagtagaggaatctaaagatcaaatggaaaaa
gaaatgcttgagaaaatagggaaattagagaaggaattagagaatgcaaatgacctgctt
tctgccacaaaacgtaaaggggccatcttgtctgaagaagagcttgcagccatgtctcct
actgcagcagccgtagctaagatagtgaaacctggcatgaagctaactgagctgtataat
gcttatgtggaaactcaggatcagctgcttttggagaaactagagaacaaaagaattaat
aagtatctagatgaaatagtgaaagaagttgaagccaaagcaccaattttgaaacgccaa
cgtgaggagtatgaacgtgcacagaaagctgtggcaagtttatctgttaagcttgaacaa
gctatgaaggagattcagcgattgcaggaggacacagataaagccaataaacattcatct
gtgcttgaaagagacaatcaaagaatggaagtacaaataaaagatctttcacaacagatt
agagtgcttctgatggaacttgaagaagcgaggggtaaccatgtaatccgtgatgaggaa
gtaagctctgctgatataagtagttcatctgaagtaatatcacagcacctagtatcttac
agaaacattgaagagcttcaacagcaaaatcaacgtctcttagtggcccttcgggaactt
ggggaaaccagagaaagagaagaacaagaagcaacttcatccaaaataactgagattcac
ctcaaacttgagagcgccctcgttgaagtggaacaactccgtgaatcacggcgacatcaa
atgcagcttgtcgattccatagttcgtcagcgtgatatgtaccgtattttgttgtcacag
acaacaggagttaccattcctttacaagcttcaagcttagatgatagttctcttatgtca
actccaaaacgttcaagtacatcacaggctgtttccactcctactccagtacctgtaatt
gagtcagcagaggctatagaagccaaggctgcccttaaacagttgcaggaaatttttgag
aactacagaaaagaaaaggcagataatgaaaaaatgcagaatgagcagcttgagaaactt
caggagcaagtcacagatttgcgatcacaaaataccaaaatttctacccagctagatttt
gcttctaaacgttatgaaatgctacaagataatgttgaaggatatcgtcgagaaataaca
tccctgcatgagagaaatcagaaactcactgcagcaactcaaaagcaggaacagatcatc
aacacaatgacacaagatttgagaggagctaatgaaaagctagctgttgcagaagtaaga
gcagaaaatttgaaaaaggaaaaggaaatgcttaaactttcagaagttcgtctttctcag
caaagagaatctttgttggctgaacaaagagggcaaaacttgctgctaactaatctgcag
acaattcagggaatattggaacgatctgaaacagaaaccaaacaaaggcttagtagccag
atagaaaaactggaacatgagatatcccatctaaagaagaagttggaaaatgaggtggaa
ctaaggcatacacttactagaaatctagatgttcaacttttagatacaaagagacagctg
gatactgagactaatcttcatcttaacacaaaagaactgttaaaaaatgctcaaaaggaa
attgctacattgaaacagcacctcagtaatgtggaagtccagcttgcttctcagtcctca
cagagaactggtaaaggtcagcctagcaacaaagaagatgtggatgaccttctgagtcag
ctaaggcaggcagaagagcaggtgaatgaattgaaggaaagactcaaaacaagcactaat
aatgtggaacagtatcgtgcaatggttaccagtttggaagagtccctcaacaaggaaaaa
caggtgacagaagaagtacataagaatattgaagttcgcttaaaagagtccgctgagttt
cagacacagctggaaaagaagttaatggaagtagagaaggaaaaacaggaacttcaggat
gacaagagaaaagccatagagagcatggaacaacagttatctgagttaaagaaaacactc
agtagtgttcagagtgaagtacaagaagctcttcagagagcaagcactgctttgactaat
gaacagcaagccagacgggactgtcaggaacaagctaaaatagctgtggaagctcagaat
aagtatgagagagaattgatgctacacgctgctgatgttgaagctctacaagctgccaag
gaacaggtttccaaaatgatgtcagtgcgtcagcacttggaagaaacagcccagaaagca
gaatcacagttgttggagtgtaaagcatcttgggaggaaagagagagaatgttaaaggat
gaagtttccaagagtgtgtctcgctgtgaagatctagaaaaacaaaacagattacttcat
gatcagattgaaaaattaagtgacaaagtcgttgcttctatgaaggaaggtgtacaaggt
ccattgaatgtatctctcagtgaagaaggaaaatcttcagaacaaattttagaaattctc
agatttatacgacgagaaaaagaaattgctgaaactaggtttgaagtggctcaggttgag
agtctgcgctatcggcaaagggttgaacttttagaaagagagctgcaggaactgcaggat
agtctaaatgctgaaagggagaaagttcaggtaactgcaaaaacaatggcccagcatgag
gaactgatgaagaaaaccgaaacaatgaatgtagttatggagaccaataagattctgagg
gaagaaaaggaaaggctagaacaggatctacaacagatgcaagccaaggtgaggaaactg
gagttagatattttacccttacaagaagcaaatgctgagctgagtgagaaaagcggtatg
ttgcaagcagagaagaagttattagaagaagatgtcaaacgttggaaagcacgtaaccag
catctagtgagtcaacagaaagatccagatacagaagaatatcgaaagctcctttctgaa
aaggaagttcatgctaagcgtattcaacaattgactgaagaaattggaaggcttaaagct
gaaattgcaagatcgaatgcatctttgactaacaaccagaacttaatccagagtctaaag
gaagatttaaataaagtaagaactgaaaaggaaagcatccagaaggacttagatgccaaa
ataattgatattcaagaaaaagttaaaactattactcaagtcaagaaaattgggcgtagg
tacaagactcaatatgaagaacttaaagcacaacaagataaggtcatggagacctcagct
cagtcttctggagaccatcaggaacagcatgtctcagtccaggaaatgcaggagctcaaa
gaaacccttaatcaagctgaaacaaagtcaaaatcactcgagagtcaggtggagaatctg
cagaaggcattatctgaaaaagaggtggaagcaagaagtctccaggaacagactgtgcag
cttcaatctgaactttcacgacttcgtcaggaccttcaagatagaaccacacaggaggag
cagctccgacagcagataactgaaaaggaagaaaaaacaagaaaggctattgtagcagca
aaatcaaaaattgcacacttagctggtgtaaaagatcagctaactaaagaaaatgaggag
cttaaacaaaggaatggagccttagatcagcagaaagatgaactggatgttcgtatgact
gctcttaagtcccagtatgaaggtcgaattagtcgcttggaaagagaactcagggagcat
caagagagacaccttgagcagagggatgagcctcaagaacctactaacaaggtcccagaa
cagcagagacagatcacgttgaaaacagctccaacttctggtgaaagaggaattgccagc
acctcagacccaccaacagccaatatcaagccaactcctgttgtgtctactccaagtaaa
gtgacagctgcagctatggctgggaataagtcaacacccagggctagtatccgcccaatg
gttacacctgcaactgttacaaatcctactactaccccaacagctacagtgatgcccact
acacaagtggaatcacaagaagccatgcaatcagaagggcctgtggaacatgttccagtt
ttcggaagcacaagtggatctgttcgttctactagtcctaacgtccagccttctatccct
caacccattttaactgttcagcaacaaacacaggctacagcctttgtgcaacccactcaa
cagagtcatcctcagattgagcctacaaatcaagagctatccccaaacatagtggaggtg
gttcagagttcaccagttgagcggccttctacttccacagcagtgtttggcactgtttca
gctaccccaagttcttctttgccgaagcgtacacgggaagaggaagaagatagcaccata
gaagcatcagaccagatctctgacgatacagtggaaatgcctcttccaaagaagttgaaa
agtgttacacctgtaggaactgaggaagaagttatggcagaagaaagtactgatggagag
gtagagactcaagtatacaaccaagattctcaagattccattggagaaggagtcacccag
ggagattatacaccaatggaagacagtgaagaaacctctcagtctctacaaatagacctt
ggacctcttcaatcagatcaacaaacaacatcatcacaagatggtcaaggcaaaggagat
gatgtcatcgtaattgacagtgatgatgaagaggaggatgatgatgaaaatgatggggaa
catgaggattatgaagaagatgaagaagaagacgatgatgatgaagatgacacagggatg
ggagacgagggtgaagatagtaatgaaggcactggtagtgcagatggcaacgatgggtat
gaagctgatgatgctgagggtggtgatgggactgatccaggtacagaaacagaagaaagt
atgggtggaggtgaaagtaatcagagagcagctgattctcaaaacagtggtgaaggaaat
actggtactgcagagtcctctttttcccaggagatttctagagaacaacagccatcatca
gcatctgaaagacagacccctcgagcacctcagtcaccaagacgcccaccacacccactt
cccccaagactgaccattcatgctccacctcaagagctaggaccaccagttcagagaatc
cagatgacccggaggcagtctgtaggacgtgggcttcagttgactccaggaataggtggc
atgcagcatttttttgatgatgaagacagaacagttccaagtaccccaactcttgttgtg
ccacatcgtactgatggatttgctgaagcaattcattccccacaggttgctggtgttccc
agattccgttttgggccgcctgaagatatgccacagacaagctctagtcactctgatctt
ggccagcttgcttctcaagggggtttgggaatgtatgaaacacccctcttcctagctcac
gaagaggagtcgggtggccgaagtgttcccactactcctctgcaagttgcagccccagtg
actgtatttactgagagtaccacctctgatgcctcagagcatgcttctcagtctgttcca
atggtgacaacatccactggcactttatccacaacgaatgaaacagcaacaggtgatgat
ggagatgaagtatttgtggaggcagaatctgaaggtattagttcagaagcaggcctcgaa
attgatagccagcaggaagaagagccggttcaggcgtctgatgagtcagatcttccttcc
accagccaggaccctccttccagttcttctgcagataccagcagtagtcagccaaagcct
ttcagacgagtaagacttcagacaacattgagacaaggtgtccgtggtcgtcaatttaac
agacagagaggtgtgagccatgcaatgggagggagaggaggaataaatagaggaaatatt
aattaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000535
Entry
103000535         CDS       T03086                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin 3
  KO
K09290  tropomyosin 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04260  Cardiac muscle contraction
bacu04261  Adrenergic signaling in cardiomyocytes
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
bacu05410  Hypertrophic cardiomyopathy
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103000535 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    103000535 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103000535 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103000535 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103000535 (TPM3)
   05414 Dilated cardiomyopathy
    103000535 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103000535 (TPM3)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     103000535 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM DUF745 Crescentin CENP-F_leu_zip XhlA DUF3450 ATG16 HrpB7 DHR10 DUF1664 SlyX Golgin_A5 Lebercilin AAA_13 Laminin_I DUF16 Fib_alpha
Other DBs
NCBI-GeneID: 103000535
NCBI-ProteinID: XP_007178573
UniProt: A0A383ZTY8
LinkDB
Position
Un
AA seq 284 aa
MEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDKY
SEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTE
ERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAE
FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaggccatcaagaaaaagatgcagatgctgaagttggacaaggagaatgctctggat
cgggcagagcaagctgaagccgagcagaagcaggcagaagaaagaagtaaacagctggaa
gatgagctggcagccatgcagaagaagctgaaagggacagaggatgagctggacaagtat
tctgaagctttgaaggatgcccaggagaagctggagctggcagagaagaaagcagctgat
gctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaagaggagctggac
cgcgctcaagagcgcctggccactgccctgcaaaagctggaggaagctgagaaagctgct
gatgagagtgagagaggtatgaaggttattgaaaaccgagccttaaaagatgaagaaaaa
atggaactccaggaaatccaactcaaagaagctaagcatattgcagaagaggcagatagg
aagtatgaagaggtggctcgtaagttggtgattattgagggagacttggaacgcacagag
gagcgagctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaatgtc
accaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagacaaa
tatgaggaagagataaagattcttactgataaactcaaggaggcagagacccgtgctgag
tttgctgagagatcggtagccaagctggaaaagacaattgatgatttggaagatgagctc
tatgcccagaaactgaagtacaaggccattagcgaggagctggaccacgccctcaatgac
atgacctctatataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002139
Entry
103002139         CDS       T03086                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like
  KO
K09290  tropomyosin 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04260  Cardiac muscle contraction
bacu04261  Adrenergic signaling in cardiomyocytes
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
bacu05410  Hypertrophic cardiomyopathy
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103002139
   04261 Adrenergic signaling in cardiomyocytes
    103002139
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002139
  09162 Cancer: specific types
   05216 Thyroid cancer
    103002139
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103002139
   05414 Dilated cardiomyopathy
    103002139
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103002139
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     103002139
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip CLZ DUF745 EzrA WES_acyltransf DUF1664 BORCS7 Lebercilin Crescentin DHR10 Fib_alpha MAD
Other DBs
NCBI-GeneID: 103002139
NCBI-ProteinID: XP_007186604
UniProt: A0A384AH92
LinkDB
Position
Un
AA seq 261 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KADRYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLDEMQSTPVPPCRCSSL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gccgatgatgcagaggagagggccgagcgcctccagcgggaagtggagggagaaaggcgg
gcccgggaacaggctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaa
gaggagctggaccgcgctcaagagcgcctggccactgccctgcaaaagctggaggaagct
gagaaagctgctgatgagagtgagagaggtatgaaggttattgaaaaccgagccttaaaa
gatgaagaaaaaatggaactccaggaaattcaactcaaagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgattattgagggagacttg
gaacgcacagaggagcgagctgagctggcagagtcccgttgccgagagatggatgagcag
atcagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagcagacagatatgaggaagagataaagattcttactgataaactcaaggaggcagag
acccgtgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgatttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctggatgagatgcagagcaccccggtcccgccctgccgctgctcctcc
ctctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003654
Entry
103003654         CDS       T03086                                 

Gene name
NTRK1
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04722  Neurotrophin signaling pathway
bacu04750  Inflammatory mediator regulation of TRP channels
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05216  Thyroid cancer
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103003654 (NTRK1)
   04014 Ras signaling pathway
    103003654 (NTRK1)
   04020 Calcium signaling pathway
    103003654 (NTRK1)
   04151 PI3K-Akt signaling pathway
    103003654 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103003654 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103003654 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103003654 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103003654 (NTRK1)
   05202 Transcriptional misregulation in cancer
    103003654 (NTRK1)
   05230 Central carbon metabolism in cancer
    103003654 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103003654 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103003654 (NTRK1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103003654 (NTRK1)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   103003654 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set TPKR_C2 LRR_8 Ig_3 TrkA_TMD Ig_2 LRR_4
Other DBs
NCBI-GeneID: 103003654
NCBI-ProteinID: XP_007172080
UniProt: A0A383ZA77
LinkDB
Position
Un
AA seq 826 aa
MVGQEEFPPAPLRLSQVLRLFEPLATSLGACHFRFRAQGAVLVKSLGSNQNPRGEGNDPV
GPRFCLVTFLNSGYLGRRCTRSGALDNLRHLPGVENLKELXVYIENQQHLWQLKLSDLRG
LGELRNLTIVKSGLRFVAPDAFHFTPRLRRLDLSFNALESLSWKTVQGLSLQELVLSGNP
LHCTCALLWLQRWEEEGLGGVREQKLQCPGQGPLALMSNTSCGVPTLKVQMPNASVDVGD
DVLLQCQVEGQGLEQAGWILTELEESATVMQSGSLPSLGLTLANVTSDLNRKNVTCWAEN
DVGRAEISVQVNVSFPASVHLQPAVEQHHWCIPFSVDGQPTPSLRWLFNGSVLNETSFIF
TEFLELAANETVRHGCLRLNQPTHVNNGNYTLLATNSLGQAAASVMAAFMDNPFEFNPED
PIPVSFSPVDTNSTSGDPVEKDETPFGVSMAVGLAVFACLFLSTTFLVLNKCGRRNKFGI
NRPTVLAPEDGLAMSLHFMTLGGSSLSPSEGKSSGLQGHIIENPQYFSDACVHHIKRRDI
VLKWELGEGAFGKVYLAECHNLLPEQDKMLVAVKALKEVSESARQDFQREAELLTMLQHQ
HIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAV
ASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLP
IRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECITQGRELERPR
ACPPEVYAIMRGCWQREPQQRHSIKDVHTRLQALAQAPPVYLDVLG
NT seq 2481 nt   +upstreamnt  +downstreamnt
atggtgggccaagaagagttccccccagccccgctgcgtctgagtcaagtccttcgcctc
tttgagcccctggcaacctccttaggagcctgtcacttccgctttcgggcgcaaggcgct
gtcctagttaagtcccttggttccaaccaaaatcctcgtggagagggcaatgaccccgtg
gggccccgcttctgtctcgtcaccttcctgaattcaggctacttggggcggcgctgcacc
cggtctggggccctggataacctccgccacctgccaggcgtcgagaacctgaaggagctt
tgagtctacatcgagaaccagcagcatctgtggcagctgaagctcagtgacctgaggggc
ctgggggagctgagaaacctcaccatcgtgaagagtggtctccgtttcgtggcgccagat
gccttccatttcactcctcgtctccgtcgcctggatctgtccttcaatgctctggagtct
ctctcctggaaaaccgtccagggcctctccctacaggaactagtcctgtcggggaacccc
ctgcactgtacctgtgccctgctctggctgcagcgctgggaggaggaggggctgggcgga
gtgcgggaacagaagctgcagtgtcccgggcagggaccccttgccctcatgtccaacacc
agctgcggtgtgcccacgctgaaggtccagatgcccaatgcctccgtggacgtgggggac
gacgtgttgctgcagtgccaggtggaggggcagggcctggagcaggccggctggatcctc
acggagctggaggagtcagccacggtgatgcaatctgggagtctgccgtccttgggactg
accctggccaatgtcaccagtgacctcaataggaagaacgtgacgtgctgggcggagaat
gacgtgggccgggctgaaatctccgtccaggtcaacgtctccttccccgccagtgtgcac
ctgcagccagcggtggagcagcaccactggtgcatccccttctccgtggacgggcagccc
acgccctctctgcgctggctcttcaatggctctgtgctcaacgagaccagcttcatcttc
accgagttcctggagctcgcagccaacgagaccgtgcgacatggctgcctgcgcctcaac
cagcccacccacgtcaacaatggcaactacacgctgctggctaccaactccttgggccag
gccgccgcctccgtcatggccgccttcatggacaaccctttcgagttcaaccctgaggac
cccatccccgtctccttctcgccagtggacaccaacagcacatccggagacccagtggag
aaggatgaaacaccttttggggtctccatggctgtgggcctggctgtttttgcctgcctc
ttcctttctacgacgtttcttgtgctcaacaaatgtggacggaggaacaagtttgggatc
aaccgccccaccgtgctggctccagaggatggactggccatgtccctgcatttcatgaca
ttgggtggcagctccttgtctcccagcgagggcaaaagctctgggctccaaggccacatc
attgagaacccacagtacttcagtgatgcctgtgttcatcacatcaagcgccgagatatc
gtgctcaagtgggagctgggcgagggcgcctttgggaaggtctacctagctgagtgccac
aacctgctgcctgagcaggacaagatgctagtggccgtcaaggcgctgaaggaggtgtct
gagagcgcccggcaggacttccagcgggaggccgagctgctcaccatgctgcagcaccag
cacatcgtgcgcttctttggcgtctgcaccgagggccgcccgctgctcatggtctttgag
tacatgcggcatggtgacctcaaccgcttcctccggtcccacgggcctgatgccaagctg
ttggctggcggggaggacgtggctccagggcctctgggcctggggcagctgctggccgtg
gctagccaggtcgccgcagggatggtgtacctggcgggtctgcacttcgtgcatcgggac
ctggccacgcgcaactgtctggtgggtcagggactagtggtcaagatcggcgatttcggc
atgagcagggatatctacagcaccgactattaccgcgtgggaggccgcaccatgctgccc
atccgctggatgccgcctgagagcatcctctaccgcaagttcaccaccgagagcgacgtg
tggagcttcggcgtggtgctctgggagatcttcacctacggcaagcaaccctggtaccag
ctctccaacacagaggcgatcgagtgcatcacgcagggacgtgagctggagcggccgcgt
gcctgcccaccggaggtctatgccattatgcggggctgctggcagcgggagccccaacaa
cgccacagcatcaaggatgtgcacacccggctgcaagcccttgcccaggcgcctcctgtc
tacctggatgtcctgggctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004609
Entry
103004609         CDS       T03086                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like
  KO
K09290  tropomyosin 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04260  Cardiac muscle contraction
bacu04261  Adrenergic signaling in cardiomyocytes
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
bacu05410  Hypertrophic cardiomyopathy
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103004609
   04261 Adrenergic signaling in cardiomyocytes
    103004609
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004609
  09162 Cancer: specific types
   05216 Thyroid cancer
    103004609
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103004609
   05414 Dilated cardiomyopathy
    103004609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103004609
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     103004609
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd DUF745 WES_acyltransf CENP-F_leu_zip DUF1664 Crescentin BORCS7 MAD Lebercilin Fib_alpha DHR10 CLZ
Other DBs
NCBI-GeneID: 103004609
NCBI-ProteinID: XP_007182312
UniProt: A0A384A4P3
LinkDB
Position
Un
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGKRRAQEQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLREAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDHNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gccgatgatgcagaggagagggccgagcgcctccagcgggaagtggagggaaaaaggcgg
gcccaggaacaggctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaa
gaggagctggaccgcgctcaagagcgcctggccactgccctgcaaaagctggaggaagct
gagaaagctgctgatgagagtgagagaggtatgaaggttattgaaaaccgagccttaaaa
gatgaagaaaaaatggaactccaggaaatccaactcagagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgattattgagggagacttg
gaacgcacagaggagcgagctgagctggcagagtcccgttgccgagagatggatgagcag
atcagactgatggaccacaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagataaagattcttactgataaactcaaggaggcagag
acccgtgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgatttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019960
Entry
103019960         CDS       T03086                                 

Gene name
TFG
Definition
(RefSeq) TRK-fused gene
  KO
K09292  protein TFG
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019960 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103019960 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 103019960
NCBI-ProteinID: XP_007164085
UniProt: A0A383YMN2
LinkDB
Position
Un
AA seq 400 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDSREEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQS
EGQMYQQYPQQAGYGTQPQAPPQPTQQYGIQYAAGYSQQTGPQQPQQFQGYGQQPASQAP
APAFSGQPQQLPAQPPQQYQASSYPPQTYTTQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTPPPGSTMTPLPSGSNPYARSRPPFGQGYTQPGPGYR
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaatgggcagttggatctgagtgggaagctaatcatcaaagctcaactgggagaggat
attcgacgaattcccattcataatgaagatattacttatgatgaattagtgctaatgatg
cagagagtcttcagaggaaaacttctgagtaatgatgaagttacaataaaatataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcctttgcaattcagtgt
agtaggatactgaaactgacgttatttgttaatggccaaccaagaccccttgaatcaagt
caggtgaaatatcttcgtcgagaactgatagaacttcgaaataaagtgaatcgcttattg
gatagcttggaaccacctggagaaccaggaccatccaccaacattcctgaaaatgatact
gtggatagtagggaagaaaagcctgctgcttctgattcttctgggaaacagtctactcag
gttatggcagcaagtatgtcagcttttgatcctttaaaaaaccaagatgaaatcaataaa
aatgtcatgtcagcatttggcttaacagatgatcaggtttcagggccacccagtgctcct
gccgaggaccgttcaggaactcccgacagcattgcttcctcctcctctgctgctcacccg
ccaggagttcagccacagcagccaccatatacaggagctcagactcaagcaggtcagagt
gaaggtcagatgtaccagcagtacccgcagcaggctggctatggcactcagccacaggcg
ccgccccagccgacgcagcagtacggtattcagtatgcagcaggctacagtcagcagact
ggaccccagcaacctcagcagttccagggatatggccagcagccagcttcccaggcaccg
gctcctgccttctctggtcagcctcagcaacttcctgctcagccgccgcagcagtaccag
gcgagcagttaccctccacagacctacactacccagacttctcagcccactaattacact
gtggcccctgcctcacaacctggaatggctccaagccaacccggggcctatcaaccaaga
ccgggtttcactccacctcctgggagtaccatgacccctcttccgagcgggtcaaaccct
tacgcacgtagccgtcctccctttggtcagggctatacccaacctggaccaggttatcga
taa

DBGET integrated database retrieval system