KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997912
Entry
102997912         CDS       T03086                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102997912 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102997912 (ADCY7)
   04371 Apelin signaling pathway
    102997912 (ADCY7)
   04020 Calcium signaling pathway
    102997912 (ADCY7)
   04072 Phospholipase D signaling pathway
    102997912 (ADCY7)
   04024 cAMP signaling pathway
    102997912 (ADCY7)
   04022 cGMP-PKG signaling pathway
    102997912 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102997912 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102997912 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102997912 (ADCY7)
   04062 Chemokine signaling pathway
    102997912 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    102997912 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    102997912 (ADCY7)
   04912 GnRH signaling pathway
    102997912 (ADCY7)
   04913 Ovarian steroidogenesis
    102997912 (ADCY7)
   04915 Estrogen signaling pathway
    102997912 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    102997912 (ADCY7)
   04921 Oxytocin signaling pathway
    102997912 (ADCY7)
   04926 Relaxin signaling pathway
    102997912 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    102997912 (ADCY7)
   04918 Thyroid hormone synthesis
    102997912 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    102997912 (ADCY7)
   04916 Melanogenesis
    102997912 (ADCY7)
   04925 Aldosterone synthesis and secretion
    102997912 (ADCY7)
   04927 Cortisol synthesis and secretion
    102997912 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102997912 (ADCY7)
   04270 Vascular smooth muscle contraction
    102997912 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    102997912 (ADCY7)
   04971 Gastric acid secretion
    102997912 (ADCY7)
   04972 Pancreatic secretion
    102997912 (ADCY7)
   04976 Bile secretion
    102997912 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    102997912 (ADCY7)
   04727 GABAergic synapse
    102997912 (ADCY7)
   04725 Cholinergic synapse
    102997912 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    102997912 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102997912 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    102997912 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    102997912 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102997912 (ADCY7)
   04714 Thermogenesis
    102997912 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997912 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    102997912 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102997912 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102997912 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102997912 (ADCY7)
   05163 Human cytomegalovirus infection
    102997912 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102997912 (ADCY7)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102997912 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 102997912
NCBI-ProteinID: XP_007167674
UniProt: A0A383YYC5
LinkDB
Position
Un
AA seq 1098 aa
MLPRLRGFLRGLLGGCQRWRMPAKGRYFLNEGEEDPSHDTLYEKYRLTSQHGPLLLTLLL
VAITACAVLIVIAFSYGDPSRHQAVLGTAFFTLAVFVALYALVYVECLVRRWLRASALLV
WACLVTLGYVLVFDSWMKEACDWEQVPFFLFVVFVVYTLLPFSTRGAVVAGVVSSTSHLL
VLGALMGAFTTPSIRVGLQLLANAVVFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRR
KLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKERGDRRYLPDNNFHSLYVKRHQNVSI
LYADIVGFTQLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSL
PSHARNCVKMGLDMCEAIKQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVS
LANRMEAAGVPGRVHITEATLNHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQP
PPPSLHLTKSKGDATLKMRASVRMTRYLESWGAARPFAHLNQRESVSSNETPVPHGRRPK
AIPLRRHRTPDRSASPKGRSEDDSYDDEMLSAIEGLSSTRPCCSKSDDFSTFGSIFLEKG
FEREYRLAPIPRARYYFACASLVFICILLVHALLMPRMAALGVSFGLVACVLGLVLGLCF
ARELLRCCPARGALRAISERVETQPLLRASLAVLTIGSLLTVAVINLPLMPFPAPGLPAG
NETGPGAMSGWERTLCKPLPYYTCSCILAFIACSVFLRMSLELKVVLLTVALVAYLVLFN
VSPCWQWDCCGHSLGNLTKANGTLSSPSCSWDLKTMINFYLVLFYTTLIMLSRQIDYYCR
LDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMF
ASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAG
LSIPSGHENQDLERQHAHIGIMVEFSTALMSKLDGINRHSFNSFRLRVGINHGPVIAGVI
GARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGEL
RTYFVCTDTAKFQGLGLN
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgctccccaggctgcggggtttcctgcgtggactgctgggcggctgccaaaggtggagg
atgccggccaaggggcgctacttcctcaacgagggcgaggaggaccccagccacgacacg
ctctacgagaagtaccgcctcaccagccagcacgggccgctgctgctcacgctcctgttg
gtggccatcactgcctgcgccgtcctcatcgtcatcgccttcagctacggggacccctcc
cgacaccaggctgtcctggggacggcgttcttcacgcttgctgtgtttgtggctctctac
gcgctcgtgtatgttgagtgcctcgtccgccggtggctcagggcctcggcgctgctcgtc
tgggcctgccttgtgacgctgggctacgtgctggtgtttgactcatggatgaaggaggcc
tgtgactgggagcaggtgcccttcttcctgttcgtggtcttcgtggtgtacacgctgctg
cccttcagcacgcggggtgccgtcgtggccggggtcgtctccagcacctcccacctcctg
gtgcttggcgcgctgatgggggccttcaccacgcccagcatccgggtagggctgcagctg
ctggccaatgctgtggtcttcctgtgcgggaacctcacgggcgccttccacaagcaccag
atgcaggatgcctcccgagacctcttcacctacactgtgaagtgcatccagatccgtcgt
aagctgcgcatcgagaagcgccagcaggagaacctgctgctgtccgtgctgccggcccac
atctccatgggcatgaagctggccatcatcgagcggctcaaggagcgtggggaccgccgc
tacctgcctgacaacaacttccacagcctctacgtcaagcggcaccagaacgtcagcatc
ctctatgctgacatcgtgggcttcacgcagctggccagcgactgctccccaaaagagctg
gtggtggtgctgaacgagctcttcggaaagttcgaccagattgccaaggccaacgaatgc
atgcggatcaagatcctgggcgactgctactactgcgtgtcaggcttgcccgtgtccctg
cccagccacgcccgcaactgtgtgaagatggggctggacatgtgtgaggccattaagcag
gtgcgggaggccacaggcgtggacatcagcatgcgtgtgggcatacactcggggaacgtg
ctgtgcggtgtcatcgggctgcgcaagtggcagtatgatgtgtggtcccatgacgtgtcc
ctggccaacaggatggaggcagctggagtccctggccgggtgcacatcacagaggcgacg
ctgaaccacctggacaaggcgtatgaggtggaggacgggcacgggcagcagcgggacccc
tacctgaaggagatgaacatccgcacctacctggtcatcgacccccggagccagcagccg
cccccgcccagcctacacctcaccaagtccaagggggacgcgaccctgaagatgcgggcc
tccgtgcgcatgacccgctacctcgagtcctggggggcggcgcggcccttcgcacacctc
aaccaacgcgagagcgtgagcagcaacgagacccctgtgccccacgggcggaggcccaag
gccattccgctgcggcgccaccggacccctgacagaagtgcgtcccccaaggggcggtca
gaggatgactcatacgacgatgagatgctgtcagccatcgagggcctcagctccacgaga
ccctgctgctccaagtctgatgacttctccacctttgggtccatcttcctggagaagggc
ttcgagcgagagtaccgcctggcacccatcccgcgggcccgctactactttgcttgtgcc
agccttgtcttcatctgcatcctgctcgtccatgccctgctgatgcccaggatggcggct
ctgggtgtgtcctttgggctggtggcctgtgtgctcgggctggtactaggcttgtgcttt
gcccgtgagctcttgaggtgctgcccggcccggggcgcgctccgagccatctccgagagg
gtggagacgcagcccctgctgcgggcgtccctggccgtcctgaccatcggcagcctgctc
actgtcgctgtcatcaacctgccgctgatgcctttcccggccccagggctgcctgctggg
aacgagacgggcccgggggccatgagcggctgggagaggaccctgtgcaagcccctcccg
tattacacctgcagctgcatcctggccttcatcgcctgctctgtcttcctgcggatgagc
ctggagctgaaggtcgtgctgttgacggtggccttggtggcctacctggtgctcttcaac
gtctccccgtgctggcagtgggactgctgtggccacagcctgggcaacctcaccaaggcc
aatggcaccctcagctccccgtcctgttcatgggatctgaagacaatgatcaatttctac
ctggtcctgttttacaccaccctcatcatgctctccagacagattgactactactgccgc
ttggattgtctgtggaagaagaagttcaagaaggaacacgaggagtttgaaaccatggaa
aatgtgaaccgccttcttctagagaatgtcctgccagcccacgtggccgcccacttcatt
ggtgacaagttaaacgaggactggtaccatcagtcctacgactgcgtgtgtgtcatgttt
gcatccgtgccggacttcaaagtattctacacggagtgcgacgtcaacaaggaagggctg
gagtgcctgcgcctgttgaacgagatcatagctgactttgacgagctgctgttaaagccc
aagttcagtggtgtggagaagatcaagaccatcggcagcacgtacatggcagctgcaggg
ctcagcatcccctcagggcacgagaaccaggacctggagcggcagcacgcccacatcggc
atcatggtggagttcagcaccgccctgatgagcaagctggatggcatcaaccggcactcc
ttcaactccttccgcctccgagttggcataaaccatgggcccgtgattgctggagtgatt
ggggcacgaaaacctcagtacgatatctggggaaacacggtcaacgttgccagtcgaatg
gagagcaccggagaacttgggaaaatccaggttactgaagagacatgtaccatcctccag
ggactaggttattcttgtgaatgccgtggactgattaacgtcaaaggcaaaggtgaactg
cggacttactttgtctgtacggatactgccaagtttcaagggttggggctgaactga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998650
Entry
102998650         CDS       T03086                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102998650 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102998650 (ADCY1)
   04371 Apelin signaling pathway
    102998650 (ADCY1)
   04020 Calcium signaling pathway
    102998650 (ADCY1)
   04072 Phospholipase D signaling pathway
    102998650 (ADCY1)
   04024 cAMP signaling pathway
    102998650 (ADCY1)
   04022 cGMP-PKG signaling pathway
    102998650 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102998650 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102998650 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102998650 (ADCY1)
   04062 Chemokine signaling pathway
    102998650 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    102998650 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    102998650 (ADCY1)
   04912 GnRH signaling pathway
    102998650 (ADCY1)
   04913 Ovarian steroidogenesis
    102998650 (ADCY1)
   04915 Estrogen signaling pathway
    102998650 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    102998650 (ADCY1)
   04921 Oxytocin signaling pathway
    102998650 (ADCY1)
   04926 Relaxin signaling pathway
    102998650 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    102998650 (ADCY1)
   04918 Thyroid hormone synthesis
    102998650 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    102998650 (ADCY1)
   04916 Melanogenesis
    102998650 (ADCY1)
   04925 Aldosterone synthesis and secretion
    102998650 (ADCY1)
   04927 Cortisol synthesis and secretion
    102998650 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102998650 (ADCY1)
   04270 Vascular smooth muscle contraction
    102998650 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    102998650 (ADCY1)
   04971 Gastric acid secretion
    102998650 (ADCY1)
   04972 Pancreatic secretion
    102998650 (ADCY1)
   04976 Bile secretion
    102998650 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102998650 (ADCY1)
   04727 GABAergic synapse
    102998650 (ADCY1)
   04725 Cholinergic synapse
    102998650 (ADCY1)
   04720 Long-term potentiation
    102998650 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    102998650 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102998650 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    102998650 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    102998650 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102998650 (ADCY1)
   04714 Thermogenesis
    102998650 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102998650 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    102998650 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102998650 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102998650 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102998650 (ADCY1)
   05163 Human cytomegalovirus infection
    102998650 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102998650 (ADCY1)
   05142 Chagas disease
    102998650 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102998650 (ADCY1)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102998650 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 102998650
NCBI-ProteinID: XP_007187748
UniProt: A0A384AK83
LinkDB
Position
Un
AA seq 907 aa
MYGVFVRILAERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITETTLACLNGDYEVEPGHGHERNSF
LKTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVMTCEDDDKRRALRTASEKLRNRSSFSTNAVYTTPGTRVNRYIGRLLEARQMELEMADL
NFFTLKYKQAERERKYHQLQDEYFTSAVILALILAALFGLVYLLIIPQSVAVLLLLVFCI
CFLVACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSSPNG
SLLVLSSGRRERLLPAPPCESAPHALLCGLVGTLPLAVFLRVSSLPKMILLAVLTTSYIL
VLELGGYTKAVGGDAVSGRSFEPIVAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERD
DMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIEL
DGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGAKAKKSI
SSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVN
VASRMDSTGVQGRIQVTEEVHRLLRRGCYRFVCRGKVSVKGKGEMLTYFLEGRTDGSGSQ
NRSMNSERKMCPYGRAGLQSRLATGHPPVPPAAGLPVRAGPGALQGSALAPCPPGHHLPP
GAAGKEA
NT seq 2724 nt   +upstreamnt  +downstreamnt
atgtacggggtcttcgtgcggatcctggctgagcgctcccagaggaaggccttcctgcag
gcccggaactgcatcgaggaccggctgaggctggaggacgagaatgagaagcaggagcgg
ctgctcatgagcctcctgccccggaatgttgccatggagatgaaggaggacttcctgaag
cccccggagaggattttccacaagatctacatccagcggcatgacaacgtgagcatcctc
ttcgccgacatcgtgggcttcacgggcttggcctcgcagtgcacggcccaggagctggtg
aaactcctcaacgagctcttcggcaagttcgacgaactggccacggagaaccactgccgc
cgcatcaagatcctgggagactgctactactgcgtgtctggcctcactcagcccaagact
gaccacgcccactgctgtgtggagatgggcctggacatgatcgacaccatcacgtccgtg
gccgaggccaccgaggtggacctgaacatgcgtgtggggctgcacaccggcagggtcctc
tgcggggtcctgggcctgcgcaagtggcagtacgacgtgtggtccaacgacgtgaccctg
gcgaacgtcatggaagccgccggcctgcctgggaaggttcacatcacagagaccaccctg
gcgtgcctgaatggtgactacgaggtggagccgggccatgggcacgagaggaacagtttt
ctgaaaactcacaacatcgagaccttttttatcgtgccctcccatcggcgaaagatattt
ccagggctgattctctcagatataaaaccggccaagaggatgaagttcaagaccgtgtgc
tacctgctggtgcagctcatgcactgccggaagatgttcaaggctgagatccctttctcc
aatgtcatgacctgcgaggacgacgacaagcggagggcattgagaacagcctcggaaaaa
ctcagaaaccgctcgtctttctctacaaatgctgtctacaccacccccgggacacgcgtc
aacaggtacatcggccgcctcctggaagcccgccagatggagctggagatggcggacctg
aacttcttcaccctgaagtacaagcaggctgagcgagagcgaaagtatcaccagcttcag
gacgagtatttcaccagcgccgtcattctggccctcatcctggccgccttattcggcctt
gtctaccttctaataatcccgcagagcgtggctgtcctgctcctgctggtgttctgcatc
tgcttcctggtggcctgtgtcctgtatctgcacatcacccgggtccagtgtttcccaggg
tgcctgacgatccagatccgcaccgtgctgtgtatcttcatcgtggtcttaatctactcc
gtggctcaaggctgtgtggtgggctgcctgccttgggcctggagctccagtcccaacggg
tccctgctggtcctgtcgtctgggcgccgggagcgcctgctgcccgccccgccctgcgag
tctgcgccccacgccctgctgtgtggcctcgtgggcaccctcccgctggctgtgttcctg
cgggtctcctccttgccgaaaatgatcctgctcgccgtgctcaccacctcctacatcctc
gtcctggagctcggcgggtacacgaaggccgtggggggtgacgccgtctcgggccgcagc
tttgagccgatcgtggccatcctcctgttctcgtgcacgctggccctgcacgcccggcag
gtggacgtcaagctgcggctggactacctgtgggccgcacaggcggaggaggagcgggac
gacatggagagggtgaagctggacaacaagaggatcctcttcaacctcctgccggcccac
gtcgcccagcacttcctcatgtccaacccccgcaacatggacctgtactaccagtcgtac
tcgcaggtgggggtcatgttcgcctccatccccaacttcaacgacttctacatcgagctg
gatggcaacaacatgggggtggagtgtctgcgcctcctgaacgagatcatcgccgacttc
gacgagctcatggacaaagatttttacaaggacctggagaagatcaagaccatcgggagc
acctacatggctgctgtggggctggcgcccacggccggggccaaggctaagaagtccatc
tcctcccacctcagcacattggcagattttgccattgagatgttcgacgtcctggatgag
atcaactaccagtcttacaacgacttcgtgctccgtgttggcatcaacgttggccccgtg
gtggctggagtgattggggctcgcaggccgcagtacgacatctggggaaatacggtcaac
gtggccagtcggatggacagcaccggcgtccagggcagaatccaggtcacggaggaagtt
caccggctgctgcggcggggctgctaccgcttcgtgtgccgaggcaaagtcagcgtcaag
ggcaagggcgagatgctgacgtacttcctggaaggcaggaccgacggaagcggctcccaa
aacaggtccatgaactcagagcggaaaatgtgtccctatgggagagccggcctccagagc
agactggccacgggccaccccccggtgccccctgcggccggcctcccagtcagagccggg
ccgggggctctgcagggctcggcgcttgccccctgccccccaggccaccacctgcccccc
ggagcagctgggaaggaggcttag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005549
Entry
103005549         CDS       T03086                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04742  Taste transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103005549 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103005549 (ADCY4)
   04371 Apelin signaling pathway
    103005549 (ADCY4)
   04020 Calcium signaling pathway
    103005549 (ADCY4)
   04072 Phospholipase D signaling pathway
    103005549 (ADCY4)
   04024 cAMP signaling pathway
    103005549 (ADCY4)
   04022 cGMP-PKG signaling pathway
    103005549 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103005549 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103005549 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103005549 (ADCY4)
   04062 Chemokine signaling pathway
    103005549 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    103005549 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    103005549 (ADCY4)
   04912 GnRH signaling pathway
    103005549 (ADCY4)
   04913 Ovarian steroidogenesis
    103005549 (ADCY4)
   04915 Estrogen signaling pathway
    103005549 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103005549 (ADCY4)
   04921 Oxytocin signaling pathway
    103005549 (ADCY4)
   04926 Relaxin signaling pathway
    103005549 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    103005549 (ADCY4)
   04918 Thyroid hormone synthesis
    103005549 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    103005549 (ADCY4)
   04916 Melanogenesis
    103005549 (ADCY4)
   04925 Aldosterone synthesis and secretion
    103005549 (ADCY4)
   04927 Cortisol synthesis and secretion
    103005549 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103005549 (ADCY4)
   04270 Vascular smooth muscle contraction
    103005549 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    103005549 (ADCY4)
   04971 Gastric acid secretion
    103005549 (ADCY4)
   04972 Pancreatic secretion
    103005549 (ADCY4)
   04976 Bile secretion
    103005549 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103005549 (ADCY4)
   04727 GABAergic synapse
    103005549 (ADCY4)
   04725 Cholinergic synapse
    103005549 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    103005549 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    103005549 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    103005549 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    103005549 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    103005549 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103005549 (ADCY4)
   04714 Thermogenesis
    103005549 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005549 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    103005549 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103005549 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103005549 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103005549 (ADCY4)
   05163 Human cytomegalovirus infection
    103005549 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103005549 (ADCY4)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103005549 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 103005549
NCBI-ProteinID: XP_007180701
UniProt: A0A384A041
LinkDB
Position
Un
AA seq 1109 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLFGLLALLAVAWASGRELASDPG
FLTTMLCGLGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGHGFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSQPALLPQSPPQPSQ
RPIQLHTIAPRPRGPAPSEADPSAQLAANAVLFLCGNVAGAYHKALMERALRATFREALS
SLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKR
HQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVS
GLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDV
WSHDVTLANHMEASGVPGRVHITGATLALLAGAYAVEDAAMEHGDPYLRELGEPTYLVID
PRAKEEDEKGTAGGLLSSLEGPKMRPSLLMTRYLESWGAAKPFAHLSHVESPVSTSTPLP
EKALSSFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSEDFNPLTLYFR
EKEMEKEYRLSALPAFKYYAACTFLVFFSNFIIQMLVTNRPPALTITYSITFLLFFLLLF
VCFSEHLTKCVLKGPKMLHWLPTLSVLVATRPGLRVALGTATILLIFSMAITSLVFLPAA
SNCPFRAPNVSSTASNLSWELPGSLPLISVPYSMHCCVLGFLSCSLFLHMSFELKLLLLL
LWLAASCSLFLHSHAWLSDCLIARLYLGTLDSRPGVLKEPKLMGAISFFIFFFTLLVLAR
QNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQS
YECVCVLFASVPDFKEFYSESSINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIC
STYMAATGLNATSGQDAQQDAEQSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLN
HGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETACALQSLGYTCYSRGI
IKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3330 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccgcggccgcctcccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctactgctgctggtgatcgtgctcttcggg
ctcttggcgctgctcgctgttgcctgggccagtggcagggagctggcctcagacccgggc
ttcctgaccactatgctgtgtgggctgggcggcttctcgctgctgctgggcctggcttcc
cgcgagcagcgactgcagcgctggacgcgtcccctgtcgggcctcgtgtgggcagcgctg
ctcgcgctaggccacggcttcctcttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctttttgtcatcttcaccgtgtatgccatgttgcccttgggcatgcgggac
gccgccgccgcgggtctcgcctcttcactctcacacctgctggtcctcgggctgtatctt
gggcctcagccagactcacagcccgcgctgctgccgcagagtcctcctcagccctctcag
agaccaatccagctacacacaatagctccccgaccccggggtccagcgccctctgaggct
gacccttccgcacagctggcggcaaacgcggtgttgttcctgtgcgggaacgtggccgga
gcataccacaaggcgctgatggagcgcgccctgcgcgccacgttccgggaggcgctcagt
tccctgcactcccgccggagactcgacaccgagaagaagcaccaggaacaccttctcttg
tccatccttcctgcctacctggcccgagagatgaaggcggagatcatggcacggctgcag
gctggacaggggtcacggccagagagcaccaacaacttccacagcctctatgtcaagagg
caccagggagtgagcgtgctgtatgctgacatcgtgggcttcacgcggctggccagtgag
tgctcccctaaggagttggtgctcatgctcaacgagctctttggcaagttcgaccagatc
gccaaggagcatgaatgcatgcggatcaagatcctgggagactgttactactgtgtctct
gggctgccgctctcgctgccggaccacgccatcaactgcgtgcgcatggggctggacatg
tgccgggccatcaggaaacttcgggcagccactggcgtggatatcaacatgcgtgtgggt
gtgcactcgggcagcgtgctctgcggagtcatcgggctgcagaaatggcagtatgatgtc
tggtcccatgacgtcactctggccaaccacatggaggcgagtggagtgccaggacgagta
catatcacaggggctacgctggcactgctggcaggggcttatgctgtggaggatgcagcc
atggaacacggggacccataccttcgggagctaggggagccgacctaccttgtcatcgat
ccccgggctaaggaggaggacgagaagggcactgcaggcgggttactgtcctctcttgag
ggccccaagatgcgtccatcactgctgatgacccgctacttggagtcctggggtgcagcc
aagcctttcgcccacctgagccatgtggagagccctgtgtccacctccacccctctcccg
gagaaggccctgtcttccttcagcccccagtggagcctggaccggagccgtaccccccgg
ggactagatgatgaactagacaccggggatgccaagttcttccaagtcatcgaacagctc
aactctcagaaacagtggaaacagtcagaggacttcaacccattgacactgtacttcaga
gagaaggagatggagaaagagtatcggctctctgcactccccgccttcaaatactatgca
gcctgcaccttcctggtttttttctccaacttcatcatccagatgctggtgacaaacagg
cccccagctctgaccatcacctatagcatcaccttcctcctcttcttcctcctcctcttc
gtctgcttctcagagcacctgacgaagtgtgtcttgaaaggccccaagatgctgcactgg
ctgcccacactgtctgtcctggtggccacacggcctggactgcgagttgccctgggcacc
gctaccatcctgctcatcttctccatggccattaccagcctggtcttcttaccggcagca
tcaaactgccctttccgggctcccaatgtgtcctccacggcttccaacctctcctgggag
ctccctgggtccctgcctctcatcagcgtcccatactccatgcactgctgcgtgctgggg
ttcctctcctgctccctcttcctgcacatgagcttcgagctgaagctgctgctgctcctg
ctgtggctggcagcctcctgctccctcttcctgcactcccacgcctggctgtccgactgt
ctcatcgcccgcctctatctgggcaccttggactccaggccaggggtgctgaaggagcct
aaactgatgggagcgatctccttcttcatcttcttcttcaccctcctggtcctggctcgg
cagaatgagtattactgccgcctggacttcctgtggaagaagaaactgaggcaggagcag
gaggagacagagacgatggaaaacctgactcggctactcttggagaacgtgctccccgcg
cacgtagccccccagttcatcggccagaatcggcgcaacgaggacctctaccaccagtcc
tacgagtgtgtttgtgtcctcttcgcctcagtcccagactttaaggagttttactctgaa
tccagcatcaaccacgaggggctagagtgtctgcggctgctcaatgagataattgctgat
tttgatgagctgctctccaagcccaagttcagtggggtggagaaaatcaaaactatctgc
agcacctacatggcagctacaggcttgaacgccacctccggacaggatgcacagcaggat
gctgagcaaagctgcagccaccttggcaccatggtagagtttgccgtggcccttgggtct
aagctggacgtcatcaacaagcactcattcaacaacttccgcttgcgtgtggggttaaac
cacggacctgtagtggccggagtgattggggcccagaaaccacaatatgacatctggggc
aacacggtgaacgtggccagccgaatggagagtacaggcgtcctgggcaagatccaagtg
accgaagagacagcctgcgccctgcagtccttaggctacacctgctacagccggggcatc
atcaaggtcaaaggcaaagggcagctctgcacctacttcctgaacacagatttgacacga
actggacctccctcggccaccctaggctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006764
Entry
103006764         CDS       T03086                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04727  GABAergic synapse
bacu04728  Dopaminergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05012  Parkinson disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05032  Morphine addiction
bacu05034  Alcoholism
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103006764 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103006764 (ADCY5)
   04371 Apelin signaling pathway
    103006764 (ADCY5)
   04072 Phospholipase D signaling pathway
    103006764 (ADCY5)
   04024 cAMP signaling pathway
    103006764 (ADCY5)
   04022 cGMP-PKG signaling pathway
    103006764 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103006764 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103006764 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103006764 (ADCY5)
   04062 Chemokine signaling pathway
    103006764 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    103006764 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    103006764 (ADCY5)
   04912 GnRH signaling pathway
    103006764 (ADCY5)
   04913 Ovarian steroidogenesis
    103006764 (ADCY5)
   04915 Estrogen signaling pathway
    103006764 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    103006764 (ADCY5)
   04921 Oxytocin signaling pathway
    103006764 (ADCY5)
   04926 Relaxin signaling pathway
    103006764 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    103006764 (ADCY5)
   04918 Thyroid hormone synthesis
    103006764 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    103006764 (ADCY5)
   04916 Melanogenesis
    103006764 (ADCY5)
   04924 Renin secretion
    103006764 (ADCY5)
   04925 Aldosterone synthesis and secretion
    103006764 (ADCY5)
   04927 Cortisol synthesis and secretion
    103006764 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103006764 (ADCY5)
   04270 Vascular smooth muscle contraction
    103006764 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    103006764 (ADCY5)
   04971 Gastric acid secretion
    103006764 (ADCY5)
   04972 Pancreatic secretion
    103006764 (ADCY5)
   04976 Bile secretion
    103006764 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    103006764 (ADCY5)
   04727 GABAergic synapse
    103006764 (ADCY5)
   04725 Cholinergic synapse
    103006764 (ADCY5)
   04728 Dopaminergic synapse
    103006764 (ADCY5)
   04726 Serotonergic synapse
    103006764 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    103006764 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103006764 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    103006764 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    103006764 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103006764 (ADCY5)
   04714 Thermogenesis
    103006764 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006764 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103006764 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    103006764 (ADCY5)
   05031 Amphetamine addiction
    103006764 (ADCY5)
   05032 Morphine addiction
    103006764 (ADCY5)
   05034 Alcoholism
    103006764 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103006764 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103006764 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103006764 (ADCY5)
   05163 Human cytomegalovirus infection
    103006764 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103006764 (ADCY5)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103006764 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 103006764
NCBI-ProteinID: XP_007175698
UniProt: A0A383ZKM3
LinkDB
Position
Un
AA seq 1018 aa
MLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHMGLACY
ALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHLA
IALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHSQR
ENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLAS
QCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMD
MIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGR
IHITKATLNYLNGDYEVEPGGGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQR
TNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGRA
IDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITIV
PHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPAPLQRLSRKIVRSKMNSTLVGVFTIT
LVFLSAFVNMFTCNSKDLLGCLADEHNISASQVNACHVAESAGNYSLGDERGFCGSPWPN
CNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPSVTLFDNADLLVT
ANAIDFNNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQAT
EEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEF
YVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKV
GKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTV
NVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPPS
NT seq 3057 nt   +upstreamnt  +downstreamnt
atgctcatggctgtgctggtgctcgtgtgcctcgtcatgttggccttccacgcggcacgg
cccccgctgcagctgccctacctggccgtgctggcggctgccgtgggtgtgatcctcgtt
atggccgtgctctgcaaccgcgccgccttccaccaggaccacatgggcctggcctgctac
gcgctcatcgccgtggtgctggctgtccaggtggtgggcctgctgctgccccagccgcgc
agcgcctccgagggcatctggtggactgtgttcttcatctataccatctacacgctgctg
cccgttcgcatgcgggccgcggtactcagcggggtgctcctgtctgccctccacctggcc
atcgccctgcgcaccaacgcccaggaccagttcctgctcaagcagctcgtctccaatgtc
ctcattttctcctgcaccaacatcgtgggcgtctgcacccactacccggctgaggtctcc
cagagacaggccttccaggagacccgggagtgcatccaggctcggctgcactcgcagcgg
gagaaccagcagcaggagcggctcctgctgtctgtccttccccgtcacgttgccatggag
atgaaagcagacatcaatgccaaacaggaggatatgatgttccataaaatttacatccag
aaacatgacaacgtgagcatcctgtttgctgacatcgagggcttcaccagcctggcgtcc
cagtgcactgcccaggagcttgtcatgaccctcaacgagctcttcgcccgcttcgacaag
ctggctgcagagaatcactgtttacgtattaagatcctgggagattgttattactgcgtc
tcagggctgcctgaagccagggctgaccatgcccactgctgcgtggagatgggcatggac
atgattgaggccatctcgctggtccgggaggtgacaggtgtcaacgtgaacatgcgtgtg
ggaatccacagcgggcgagtgcactgtggcgtccttggcctcaggaagtggcagttcgac
gtctggtctaacgacgtcacgctggccaaccacatggaggctggaggcaaggcgggacgc
atccacatcaccaaggccacactcaactacctgaatggcgactacgaagtggagccgggc
ggtgggggcgagcgcaacgcctacctcaaagagcacagtatcgagaccttcctcatcctg
cgctgcacccagaagcggaaagaagagaaggccatgattgccaagatgaatcgccagaga
accaactcgatcgggcacaacccaccacactggggggccgagcgccccttctacaaccac
ctgggtggcaaccaggtgtccaaggagatgaaacggatgggctttgaagatcccaaggac
aagaacgcccaggaaagtgcgaaccccgaggatgaagtggatgaatttctgggccgtgcc
attgacgccaggagcatcgacaggctacgatctgagcatgttcgcaagttcctcttgacc
ttcagggagcctgacttagagaagaagtactccaagcaggtggatgaccgattcggtgcc
tacgtggcatgtgcctcgctcgtcttcctcttcatctgctttgtccagatcaccattgtg
ccccactccgtgttcatgttgagtttctacctgacctgtttcctgctgctgaccttggtg
gtatttgtgtccgtgatctactcctgcgtgaagctcttcccggccccgctgcagaggctc
tccaggaagatcgtgcggtccaagatgaacagcaccctggtgggcgtgttcaccatcacc
ctggtgttcctgtcggctttcgtcaacatgttcacgtgcaactccaaggacctgcttggc
tgcctggcggacgaacacaacatcagtgccagccaggtcaacgcgtgccacgtggcggag
tcagccggcaactacagcctgggtgacgagcggggcttctgcggcagcccctggcccaac
tgcaacttccccgagtacttcacctatagcgtgctgctcagcctgctggcctgctccgtg
ttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgagctcatctac
gtgcttgtcgttgaggtgcccagtgtcacgctctttgacaatgccgacctactggtcaca
gccaacgccatagacttcaacaacaacgggacctcccagtgccctgagcacgcgaccaag
gtggcgctgaaggtggtgacacccatcatcatctcggtcttcgtgctggccctgtacctg
cacgcgcagcaggtggagtccaccgcccgcctcgacttcctctggaaactgcaggccacc
gaggagaaggaggagatggaggagctgcaggcctacaaccggcggctgctgcacaacatc
ctgcccaaggatgtagccgcgcacttcctggcccgcgagcggcgcaacgatgagctctac
tatcagtcgtgtgagtgcgtggccgtcatgttcgcctccatcgccaacttctccgagttc
tacgtggagctggaggccaacaacgagggcgtcgagtgcctgcggctgctcaacgagatc
atcgccgactttgacgagatcatcagtgaggatcggttcaggcagctggaaaagatcaag
accatcggcagcacctacatggccgcctcgggcctcaatgactccacctatgacaaggtg
ggcaagacccacatcaaagctctggctgacttcgccatgaagctgatggaccaaatgaag
tacatcaacgagcactccttcaacaacttccagatgaagattgggctcaatatcggcccc
gtagtggctggggtgattggggcccgcaaacctcagtacgacatctggggcaatacagtg
aacgtggccagccgcatggacagcaccggcgtgcccgaccgcatccaggtcaccacagac
atgtaccaggtgctggccgccaacacgtaccagctggagtgccggggtgtggtcaaggtc
aagggcaaaggcgagatgatgacatacttcctcaacggagggcccccgcccagttag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014094
Entry
103014094         CDS       T03086                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04742  Taste transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04962  Vasopressin-regulated water reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103014094 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103014094 (ADCY6)
   04371 Apelin signaling pathway
    103014094 (ADCY6)
   04072 Phospholipase D signaling pathway
    103014094 (ADCY6)
   04024 cAMP signaling pathway
    103014094 (ADCY6)
   04022 cGMP-PKG signaling pathway
    103014094 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103014094 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103014094 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103014094 (ADCY6)
   04062 Chemokine signaling pathway
    103014094 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    103014094 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    103014094 (ADCY6)
   04912 GnRH signaling pathway
    103014094 (ADCY6)
   04913 Ovarian steroidogenesis
    103014094 (ADCY6)
   04915 Estrogen signaling pathway
    103014094 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    103014094 (ADCY6)
   04921 Oxytocin signaling pathway
    103014094 (ADCY6)
   04926 Relaxin signaling pathway
    103014094 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    103014094 (ADCY6)
   04918 Thyroid hormone synthesis
    103014094 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    103014094 (ADCY6)
   04916 Melanogenesis
    103014094 (ADCY6)
   04924 Renin secretion
    103014094 (ADCY6)
   04925 Aldosterone synthesis and secretion
    103014094 (ADCY6)
   04927 Cortisol synthesis and secretion
    103014094 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103014094 (ADCY6)
   04270 Vascular smooth muscle contraction
    103014094 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    103014094 (ADCY6)
   04971 Gastric acid secretion
    103014094 (ADCY6)
   04972 Pancreatic secretion
    103014094 (ADCY6)
   04976 Bile secretion
    103014094 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103014094 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103014094 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    103014094 (ADCY6)
   04727 GABAergic synapse
    103014094 (ADCY6)
   04725 Cholinergic synapse
    103014094 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    103014094 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    103014094 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    103014094 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    103014094 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    103014094 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103014094 (ADCY6)
   04714 Thermogenesis
    103014094 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014094 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    103014094 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103014094 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103014094 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103014094 (ADCY6)
   05163 Human cytomegalovirus infection
    103014094 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103014094 (ADCY6)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103014094 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 103014094
NCBI-ProteinID: XP_007179335
UniProt: A0A383ZW21
LinkDB
Position
Un
AA seq 1220 aa
MSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRSSGFCTPRYMSCFQGAQPPSPTPAATP
RCPWQDEAFIRRGGPGKGLELGLRAVALGFEDPEATVAVGAAEGAPDAAARSRRACWCRL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPAHPQPAYVA
LLACAAILFVALMVVCNRHSFRQDSMWLVSYVVLGILAAVQVGGALAASPHSPSVGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRARANSMEGLMPRWVPDRTFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLVFPPSALMLGIYASTFLLLLVTVLTCAVYSCGS
LFPAALRRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLTPA
DITACHLQQLNYSLGLDAPLCEGTAPSCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMI
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFSGLDCSAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQQAVRGPCSSALRLVN
EGIPRGLCKWLSFLTGVGAVFSPFSQLLGAGEGAAAEAGGCLLPERLKWQLATPALSLSV
WALGSGLGPSFPSFSWEYFV
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccccaaagtggatgaacggaaaacagcctggggc
gagcgcaatgggcagaagcgtccccgccgcgggactcgctccagcggcttctgcacaccc
cgttatatgagctgctttcaaggtgcacagccacccagcccgacccccgcagccacgcct
cggtgcccctggcaggatgaggccttcatccggaggggtggcccaggcaagggcctggag
ctggggctgcgggccgtggccctgggcttcgaggaccctgaggcgaccgtggcagtcggg
gccgctgagggggcccccgacgcggccgccaggagcaggcgagcttgctggtgccggctg
gtgcaggtgttccagtcgaagcagttccgctcggccaagctggagcgcttgtaccagagg
tacttcttccagatgaaccagagcagcctgacactgctgatggcggtgctcgtgctgctc
acggccgtgctgctggccttccacgcggcgcctgcccaccctcagcctgcctacgtggcg
ctgctggcctgcgccgccatcctcttcgtggcgctcatggtggtgtgcaaccgacacagc
ttccgccaggactccatgtggctggtgagctacgtggtgctgggcatcctggcagcggtg
caggtcggcggcgccctggcagccagcccccacagcccttctgtaggcctctggtgcccc
gtgttcttcgtctacatcacctacacgctcctccccatccgcatgcgggccgctgtcttc
agtggcctgggcctctccaccctgcacttgatcttggcctggcagctcaaccgtggtgat
gccttcctctggaagcagctcggtgccaacatgctgctgttcctctgcaccaatgtcatt
ggcatctgcacacactacccggctgaggtgtctcagcgccaggcctttcaggagacccgt
ggttacatccaggcccggctgcacctgcagcatgagaatcggcagcaggagcggctgctg
ctgtctgtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgtttcacaagatctacatccagaagcatgacaatgtcagcatcctgttt
gcggacattgaaggcttcaccagcctggcatcccagtgcacggcgcaggagctggtcatg
accctgaacgagctctttgcccggtttgacaagctggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactattgtgtgtcagggctgccggaggcccgggcagac
catgcccactgctgcgtggagatgggggtggacatgatcgaggccatctcgctggtgcgc
gaggtgacaggtgtgaacgtgaacatgcgcgtgggcatccacagtgggcgcgtgcactgc
ggcgtccttggcctgcggaaatggcagttcgatgtgtggtccaatgacgtgactctggcc
aatcacatggaggccgggggccgggccggccgcatccacatcactcgggccacgctgcag
tacctgaacggggactatgaggtggagccgggccgcggcggggagcgcaacgcctacctc
aaggagcagcacattgagaccttcctcatcctgggagccagccagaaacggaaagaggag
aaggccatgctggccaagctgcagcgggcgcgggccaactccatggaggggctgatgcca
cgctgggtgcccgaccgcaccttctcccggaccaaggactccaaggctttccggcagatg
ggcattgatgattccagcaaagacaaccggggtgcccaggacgccctgaaccctgaggat
gaggtagacgagttcctgggccgtgccatcgatgcccgcagcatcgatcagctgcgcaag
gaccacgtgcgccggttcctgctcaccttccagagagaggatcttgaaaagaagtactcg
cgaaaggtggacccccgcttcggagcctacgtggcctgtgccttgttggtcttctgcttc
atctgcttcatccagctcctcgtcttcccaccctcagccctgatgcttgggatctatgcc
agtaccttcctgctgttgctggtcaccgtgctgacctgcgccgtgtactcctgtggctct
ctgttccctgcggccctgcgacgtctgtctcgcagcatcgtccgctcgcgggcacacagc
actgcggttggcatcttttccgtcctgcttgtgttcacctctgccatcgccaacatgttc
acctgtaaccacacccccatacggacttgcgcagcccggatgctgaatttaacgcctgct
gacatcaccgcctgccacctgcagcagctcaattactcactgggcctggatgctcccctg
tgtgagggcaccgcacccagttgcagcttccctgagtacttcgtcgggaacatgttgctg
agtctcttggccagctccgtcttcctgcacatcagtagcatcgggaagctggccatgatc
tttgttctggggctcatctatttggtgctgcttctgctgggtcccccggccaccatcttt
gacaactatgacctactgcttggcgtccatggcttggcttcttccaacgagaccttcagt
gggctggactgctcagccgcagggagggtggcactcaaatatatgacccccgtgattctg
ctggtgtttgcactggcgctgtatctgcatgcccagcaggtggaatcaactgcccgcctg
gacttcctctggaaactgcaggcaacaggggagaaggaggagatggaggagctccaggca
tacaaccggcggctgctacataacattctgcccaaggacgtggctgcccacttcctcgcc
cgggagcgccggaatgatgagctctactatcagtcatgtgagtgtgtggccgtcatgttt
gcctccattgccaacttctctgagttctacgtggagctagaggcaaacaatgagggtgtc
gagtgcctgcggctgctcaacgagatcatcgctgacttcgatgagatcatcagcgaggag
cggttccggcagctggagaagatcaagacgattggtagcacctacatggctgcttctggg
ctgaatgccagcacctatgatcaggtgggccgctcccacatcactgcccttgccgactac
gccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccag
atgaagatcgggctgaacatgggcccagttgtggcaggcgtcattggggctcggaagccg
cagtatgacatctgggggaacacagtgaatgtctctagccgcatggacagcacgggggtc
cccgaccgaatccagcaggctgtacgtggaccatgctcgtctgccctcaggctggtgaat
gaggggataccaagaggattatgcaagtggctttctttcttaactggggtaggggctgtt
ttctctcctttttcccagcttttgggagcaggggagggggcagcagcagaggcaggggga
tgtctcctgcctgagaggttaaaatggcagcttgccacgcccgccctttccctgtctgtc
tgggcactaggctcagggctgggcccttcctttccctctttttcctgggaatattttgta
taa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016058
Entry
103016058         CDS       T03086                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04962  Vasopressin-regulated water reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103016058 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103016058 (ADCY9)
   04371 Apelin signaling pathway
    103016058 (ADCY9)
   04020 Calcium signaling pathway
    103016058 (ADCY9)
   04072 Phospholipase D signaling pathway
    103016058 (ADCY9)
   04024 cAMP signaling pathway
    103016058 (ADCY9)
   04022 cGMP-PKG signaling pathway
    103016058 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103016058 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103016058 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103016058 (ADCY9)
   04062 Chemokine signaling pathway
    103016058 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    103016058 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    103016058 (ADCY9)
   04912 GnRH signaling pathway
    103016058 (ADCY9)
   04913 Ovarian steroidogenesis
    103016058 (ADCY9)
   04915 Estrogen signaling pathway
    103016058 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    103016058 (ADCY9)
   04921 Oxytocin signaling pathway
    103016058 (ADCY9)
   04926 Relaxin signaling pathway
    103016058 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    103016058 (ADCY9)
   04918 Thyroid hormone synthesis
    103016058 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    103016058 (ADCY9)
   04916 Melanogenesis
    103016058 (ADCY9)
   04925 Aldosterone synthesis and secretion
    103016058 (ADCY9)
   04927 Cortisol synthesis and secretion
    103016058 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103016058 (ADCY9)
   04270 Vascular smooth muscle contraction
    103016058 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    103016058 (ADCY9)
   04971 Gastric acid secretion
    103016058 (ADCY9)
   04972 Pancreatic secretion
    103016058 (ADCY9)
   04976 Bile secretion
    103016058 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103016058 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103016058 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    103016058 (ADCY9)
   04727 GABAergic synapse
    103016058 (ADCY9)
   04725 Cholinergic synapse
    103016058 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    103016058 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103016058 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    103016058 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    103016058 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103016058 (ADCY9)
   04714 Thermogenesis
    103016058 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016058 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    103016058 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103016058 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103016058 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103016058 (ADCY9)
   05163 Human cytomegalovirus infection
    103016058 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103016058 (ADCY9)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103016058 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 AC_N
Other DBs
NCBI-GeneID: 103016058
NCBI-ProteinID: XP_007181604
UniProt: A0A384A316
LinkDB
Position
Un
AA seq 1353 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRMGAGGRLRRKKKLPQLFERASSRWWDPKFDSMNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSKLTVMVAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRVDSFNHTRAARPTETCLSQVGNFSMCIEVLFLLYTVMHL
PLYLSLILGVAYSVLFETFGYHFQDKACFPSPGAEGLHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQNVVADQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVIDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCRITFAPKLEAGAEGGAVQNGCQEEPKN
STKASGGPSSKTQNGLLSPPPEEKLTNSQTSLCEILQEKGRWTGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELEQAYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAASTPPPPAALVVFGAALLLEVLSLVVSVR
MVFFLEDVMACTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHSTVFTGS
AVLITVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSIVISHLDAVQNFSSER
NPCNASLPHDSRSPASLIGQEVILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDNGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNATQCRDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDSGMVPQHQLSISP
DIRVQVDGSIGRSPTDEITNLVPSLQNPDQVSLGSENNTQARDTHPSSKRPWKEPIKAEE
RCRFSKAIEKSDCEEAGVEEANELTKLNVSKRA
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcagcaccacagcaccgaggtgagttgtgac
tccagcggagacagcaacagcgtgagggtcaaaatcaaccccaagcagctgtcctccaac
agccacccaaaacactgcaagtacagcatctcctccagctgtagcagctccggggactca
gggggtgtcccccggagaatgggcgccggaggccgcctgcgcaggaaaaagaagctgcct
cagctgttcgagagggcctccagccggtggtgggaccccaaattcgactccatgaacctg
gaggaggcttgcatggagcgctgcttcccgcagacccagcgccgcttccggtatgcgctc
ttctacattggcttcgcctgccttctctggagcatctattttggggtccacatgagatcc
aaactgactgtcatggtagcccctgctctgtgcttcctcgtggtgtgtgtgggctttttt
ctgtttaccttcaccaagctgtacgcccggcattacgtgtggacctcgctggttctcacc
ctcctggtgttcgccctgaccctggctgcccagtttcaggttttgacacccctctcagga
cgagttgacagcttcaatcatactcgggcagccaggcccacagaaacttgcttatctcaa
gtggggaacttttccatgtgcattgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgattttgggagtggcctattctgttctttttgagacctttggc
tatcatttccaagacaaagcctgcttcccctcacctggagcagagggcctgcactgggag
ctgctgagccgagccctgctccacgtctgcattcatgccattgggatccacctgttcatc
atgtcccaggtgagatccaggagcaccttccttaaggtgggccagtcaattatgcatgga
aaggatctggaagtggaaaaagccctgaaggagaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaagcagggggacgaggagagcgagaattctgtcaaaagg
cacgccacctccagccccaagaacaggaagaaaaagtcttccatacagaaagcccctatt
gccttccgcccgtttaaaatgcagcagatcgaagaagtcagtattttattcgcagatatc
gtgggcttcaccaagatgagtgccaataagtccgcccatgccctggtggggctcctcaac
gatctgttcggccgcttcgaccggttgtgcgaggagaccaagtgtgagaaaatcagcacc
ctgggagactgctactattgtgtggccggatgtcccgagcctcgggccgaccatgcctac
tgctgcatcgaaatgggcttgggcatgataagggctatcgagcagttctgccaagagaag
aaagagatggtgaacatgcgcgtcggggttcacacggggactgtcttgtgcggcatcttg
ggcatgaggaggtttaaattcgacgtgtggtccaatgacgtgaacttggccaatctcatg
gagcagctgggagtggctggcaaggttcacatttccgaggccaccgcaaaatacctagat
gaccggtacgaaatggaagatgggaaggttactgaacgcctcggccagaacgttgttgct
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcat
tgcagctgttcagaggccttgctttctggctttgaggtcattgacggctcacgggtgtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccgtcgtgcagaatcacatttgctcccaaa
ttggaagctggcgccgaaggcggagcagtccagaatggctgtcaggaggagcccaagaac
agcaccaaggcttctggaggacccagttccaaaacgcaaaacggactgctgagccctccc
ccggaggagaagctcaccaacagtcagacctccctgtgcgagatcttacaggagaaggga
aggtggacaggtgtgagcttggaccagtcagccctccttccgctgaggttcaagaacatc
cgggagaagacggatgcccattttgttgatgttatcaaggaagacagcctgatgaaagat
tatttttttaagccacccattaatcagttcagcttgaacttcctggatcaggagctagaa
caagcctacaggaccagctatcaagaagaggttataaagaattctcccgtgaagactttt
gccagtgccaccttcagctccctcctggatgtgtttctgtcgacaacagtgtttctgatt
ctctccatcacctgcttcctgaagtatggggccgcctccacaccacccccgccggctgcc
ctggtggtcttcggagcagccctgcttctggaggtcctgtccctcgtggtctctgtcagg
atggtgttcttcctggaggatgtgatggcttgtaccaagcgcctgctggagtggatagcc
ggctggctcccgcgccatttcatcggggccatcctggtgtccctccccgccctcgcggtc
tattcacatgtcacctccgaatttgagacaaacatacactccaccgtgttcacgggctcg
gctgtcctgatcaccgtggtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccttggccacagtcgtcggggccgggcccctgctgctgctctacgtctccctctgc
cccgacagttccatagtaatttcacacctggatgcagtacagaatttcagctccgagagg
aatccatgcaatgcctcgctgccgcacgacagcaggagcccagccagcctgattggccag
gaggtgattcttgtcttcttcctcctgctcttgttggtctggttcctgaatcgagaattc
gaagtcagctaccgcctacactaccacggggacgtggaggcggacctgcaccgcactaag
atccagagcatgagggaccaggccgactggctgctgagaaacatcatcccctaccacgtg
gccgagcagctgaaggtctcccagacctactccaagaaccacgacaacggaggagtcatc
ttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggag
tgctaccgggtcctcaacgagctgatcggggacttcgacgagctcctgagcaagccggac
tacagcagcattgagaagatcaagaccatcggggccacatacatggccgcgtcggggctg
aacgccacgcagtgccgtgacggcagccacccacaggagcacctgcagatcctgttcgag
ttcgccaaggagatgatgcgcgtggtggacgacttcaacaataacatgctctggttcaac
ttcaagctcagggtgggcttcaaccatgggcccctgacggcgggcgtcattggcaccacc
aagctgctgtacgacatctggggagacacggtcaacatcgccagcaggatggacaccacg
ggggtggagtgccgcatccaggtcagcgaggaaagctaccgcgtcctgagcaagatgggc
tacgacttcgactacagagggacggtgaacgtcaagggcaaaggccagatgaagacctac
ctgtaccccaagtgcacggacagtgggatggtgccgcagcaccagctctccatctccccc
gacatccgagtccaggtggacggcagcatcggacgctcccccacggacgagatcaccaac
ctggtgccttccttacagaacccggaccaggtgtccctgggctccgagaacaacacacag
gccagggacactcacccgtcttctaagaggccctggaaggagcccatcaaagccgaagaa
aggtgtaggttcagcaaagccatagagaaaagcgactgtgaagaagcgggggtggaggaa
gccaatgaactcaccaagctcaacgtctcaaagagggcgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019172
Entry
103019172         CDS       T03086                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04742  Taste transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103019172 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103019172 (ADCY8)
   04371 Apelin signaling pathway
    103019172 (ADCY8)
   04020 Calcium signaling pathway
    103019172 (ADCY8)
   04072 Phospholipase D signaling pathway
    103019172 (ADCY8)
   04024 cAMP signaling pathway
    103019172 (ADCY8)
   04022 cGMP-PKG signaling pathway
    103019172 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103019172 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103019172 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103019172 (ADCY8)
   04062 Chemokine signaling pathway
    103019172 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    103019172 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    103019172 (ADCY8)
   04912 GnRH signaling pathway
    103019172 (ADCY8)
   04913 Ovarian steroidogenesis
    103019172 (ADCY8)
   04915 Estrogen signaling pathway
    103019172 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    103019172 (ADCY8)
   04921 Oxytocin signaling pathway
    103019172 (ADCY8)
   04926 Relaxin signaling pathway
    103019172 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    103019172 (ADCY8)
   04918 Thyroid hormone synthesis
    103019172 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    103019172 (ADCY8)
   04916 Melanogenesis
    103019172 (ADCY8)
   04925 Aldosterone synthesis and secretion
    103019172 (ADCY8)
   04927 Cortisol synthesis and secretion
    103019172 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103019172 (ADCY8)
   04270 Vascular smooth muscle contraction
    103019172 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    103019172 (ADCY8)
   04971 Gastric acid secretion
    103019172 (ADCY8)
   04972 Pancreatic secretion
    103019172 (ADCY8)
   04976 Bile secretion
    103019172 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    103019172 (ADCY8)
   04727 GABAergic synapse
    103019172 (ADCY8)
   04725 Cholinergic synapse
    103019172 (ADCY8)
   04720 Long-term potentiation
    103019172 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    103019172 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    103019172 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    103019172 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    103019172 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    103019172 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103019172 (ADCY8)
   04714 Thermogenesis
    103019172 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019172 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    103019172 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103019172 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103019172 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103019172 (ADCY8)
   05163 Human cytomegalovirus infection
    103019172 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103019172 (ADCY8)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103019172 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 103019172
NCBI-ProteinID: XP_007188955
UniProt: A0A384ANN7
LinkDB
Position
Un
AA seq 1248 aa
MELSDVRCLSGSEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFVHGHRGGSGG
GSGSSSKASDPVGGGLNHHHASQLAGDSALPLYALGPGERAHSPGCTKVFPERSGSGGGG
GAGDLGFLHLDCAPSNSDFFLKGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSE
VVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHTYL
QYSGVVTWVAMATQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTSLL
QVVLQGVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLR
LETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKG
FTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCC
VEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLES
GGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPEDIV
KESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQS
GPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFIV
LLFITAIQSLLPSSRVMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWINETY
LARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTGVL
AMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDKLNHSGEDFLGTKEASL
LLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARH
FLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELL
GEDRFQDIEKIKTIGSTYMAVSGLSPDKQQCEDKWEHLCALADFSLALTESIQEINKHSF
NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKD
QGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQS
LNRQRQKQLLNKNNTGIIKGHYNRRTLLTPSGPEPGAQAEGTDKSELP
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttagcggcagcgaggagctctacaccatccacccg
acgcccccggccggcgacggcgggagcggctcccggccgcagcggctgctgtggcaaacg
gcggtgcggcacatcaccgagcagcgcttcgttcacgggcaccgggggggcagcggcggc
gggagcgggagctccagcaaagcctcggaccctgtgggcggcggcctcaaccaccaccac
gcgtcgcagctggccggcgactcggcgctgcccctctacgcgctgggccccggggagaga
gcgcacagccccggctgcaccaaagtcttcccggaacgcagcggcagcggcggcggcggc
ggcgcgggcgacctgggcttcctgcacctcgactgcgccccgagcaactcggatttcttc
ctcaaggggggctatagctaccgaggggtcattttccccaccctgcgcaactccttcaag
tcccgggatctggagcgcctgtaccagcgctatttcctgggccagaggcgcaaatcggag
gtggtgatgaacgtgctggacgtactgaccaaactcactctcttggttctgcacttgagc
ctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacgggcata
gaggtggtgatctgcgccttggtggtggtcaggaaggacaccacgtcgcacacctacctg
cagtacagcggcgtggtcacctgggtggccatggccacccagatcttagcagcaggtctg
ggctatgggctcctgggagacggcattggctacgtgctcttcacgctcttcgccacctac
agcatgctgccgctgccgctcacctgggccatcctggcgggcctgggcacgtcgttactg
caggtggtcctccagggggtcatccccaggctggcggtcatttccatcaaccaggttgtg
gcccaggcagtgttattcatgtgtatgaacacggctggaatctttatcagttacctgtca
gaccgggcccagcgccaagccttcctggagacgcggaggtgtgtggaagccaggctgcgc
ctagagacggaaaaccaaagacaggagcggcttgtgctgtctgtgctccctcggtttgtc
gtcctggagatgatcaacgacatgaccaacgtggaagacgaacacctgcagcatcaattc
caccggatctacatccatcgctacgagaatgtcagtattctttttgcagatgttaaagga
tttaccaacctctccacgaccttgtctgcccaggagctggtcaggatgctcaacgagctc
tttgccagatttgatcgactggcccatgagcatcactgcctccgcattaaaatcctgggg
gactgctactactgcgtttcgggacttcctgagccccgccaggaccacgcccactgctgc
gttgaaatgggcctcagcatgatcaaaaccatcaggtatgtgcggtcaaggacgaagcat
gatgttgacatgcggattggaatccattcgggctcagtgctatgtggcgtgttgggtcta
cggaagtggcagtttgatgtctggtcttgggatgtggatattgcaaacaaacttgaatct
ggaggaatccctgggaggattcacatttccaaagccacgctggactgcctcaatggtgac
tataatgtggaagagggtcatggtaaagagaggaacgaattcttgaggaagcataacata
gagacctatttaattaagcagcctgaggagagtctgctgtctttgcctgaagacatcgtc
aaggagtctgtgagctcctcagacaggagaaacagtggggcgacattcacagaaggatcc
tggagccccgaactgccctttgataacatagtggggaaacagaacactctggctgcccta
acaagaaattcaataaatctacttccaaaccatctcgcacaagctttgcatgtccagtcg
gggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggcgataaa
ttgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctggagcac
aagtattctcaaatgagggacgaagtattcaaatcaaacttggtctgtgcgtttatcgtt
cttctatttatcacggcaatacaaagtttgcttccttcctcaagggtgatgccaatggcc
atccagttttccatcctgattatgctgcactcggctctggtcctcatcaccacagcggag
gattataagtgtttgcccctggtcctccggaaaacttgctgttggattaacgagacctat
ttggccaggaatgtcatcatctttgcgtccatcttgattaatttcctgggcgccatccta
aatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttcaattcc
tcagctgtgtttacagatatctgctcctacccagagtacttcgtcttcacgggggtgttg
gccatggtgacctgtgcggttttcctccgacttaactctgtcctgaagctggctgtgctg
ctgattatgattgccatctatgcccttctgaccgagaccatctatgcaggactctttctg
cgctatgacaaactgaatcacagtggagaagatttcctggggaccaaggaggcgtcactg
ctgctgatggccatgttcctcctcgctgtcttctaccatggacagcagctggagtacaca
gcacgcctggacttcctctggcgagttcaggccaaagaggagatcaacgagatgaaggag
cttcgggaacacaatgagaacatgctccggaacattctgcccagtcacgtggcccgccac
ttcctggagaaggaccgggacaacgaggagctgtattctcaatcctatgatgccgttggg
gtgatgtttgcctccatcccagggtttgcagacttctactctcagactgaaatgaacaac
caaggagtggaatgcctacgcctgctgaatgagatcattgccgacttcgatgagctgctt
ggtgaagaccggtttcaagacattgaaaagattaagaccatcggcagcacctacatggcc
gtgtcaggcctgtcacctgacaaacagcaatgtgaagataagtgggaacatctgtgcgcc
ctggccgatttctctctcgccctgaccgaaagcatacaggagatcaacaagcattctttc
aacaactttgagctcaggattggcatcagccacggctcagtggtagctggcgttatcggc
gctaagaaaccacagtatgacatttggggcaaaaccgtgaacctggcaagtcggatggac
agcacaggagtcagcggcagaatccaggtccccgaggagacctatctcatcctgaaggac
cagggctttgcctttgactaccgaggggagatctatgtgaagggcatcagtgaacaggaa
ggaaaaatcaaaacgtactttctcctgggaagagtccagcccaacccattcatcctgccg
ccgagaagactgcccgggcagtactccttggccgccgtcgtcctgggcctcgtccagtcc
ctcaacaggcaaaggcagaagcagctgctgaacaagaacaacacgggcatcatcaagggc
cattacaaccggcggactttgctgacacccagcgggcctgagccgggagcccaagccgaa
ggcaccgacaagtccgagttgccataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020085
Entry
103020085         CDS       T03086                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103020085 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103020085 (ADCY2)
   04371 Apelin signaling pathway
    103020085 (ADCY2)
   04020 Calcium signaling pathway
    103020085 (ADCY2)
   04072 Phospholipase D signaling pathway
    103020085 (ADCY2)
   04024 cAMP signaling pathway
    103020085 (ADCY2)
   04022 cGMP-PKG signaling pathway
    103020085 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103020085 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103020085 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103020085 (ADCY2)
   04062 Chemokine signaling pathway
    103020085 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    103020085 (ADCY2)
   04922 Glucagon signaling pathway
    103020085 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    103020085 (ADCY2)
   04912 GnRH signaling pathway
    103020085 (ADCY2)
   04913 Ovarian steroidogenesis
    103020085 (ADCY2)
   04915 Estrogen signaling pathway
    103020085 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    103020085 (ADCY2)
   04921 Oxytocin signaling pathway
    103020085 (ADCY2)
   04926 Relaxin signaling pathway
    103020085 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    103020085 (ADCY2)
   04918 Thyroid hormone synthesis
    103020085 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    103020085 (ADCY2)
   04916 Melanogenesis
    103020085 (ADCY2)
   04925 Aldosterone synthesis and secretion
    103020085 (ADCY2)
   04927 Cortisol synthesis and secretion
    103020085 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103020085 (ADCY2)
   04270 Vascular smooth muscle contraction
    103020085 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    103020085 (ADCY2)
   04971 Gastric acid secretion
    103020085 (ADCY2)
   04972 Pancreatic secretion
    103020085 (ADCY2)
   04976 Bile secretion
    103020085 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103020085 (ADCY2)
   04727 GABAergic synapse
    103020085 (ADCY2)
   04725 Cholinergic synapse
    103020085 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    103020085 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103020085 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    103020085 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    103020085 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103020085 (ADCY2)
   04714 Thermogenesis
    103020085 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020085 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    103020085 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103020085 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103020085 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103020085 (ADCY2)
   05163 Human cytomegalovirus infection
    103020085 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103020085 (ADCY2)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103020085 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 103020085
NCBI-ProteinID: XP_007191699
UniProt: A0A384AWB8
LinkDB
Position
Un
AA seq 972 aa
MGYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTVVLSVCLSA
MPGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQ
QERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGF
TRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCV
KMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAG
GVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRP
RPTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQSRT
LRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRATALPA
FKYYVTCACLIFFCIFIVQILVLPKTSILGISFGAAFLSLAFILFVCFAGQLLQCSKKAS
ASLLWLLKSSGIIATRPWPRISLTVITTAIILTMAVFNMFFLSESEETILPTANASNTSL
SALYNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMAALVGYNTIFLH
THAHLLDDYSQVLFERPGIWKDLKTMGSVSLFIFFITLLVLGRQNEYYCRLDFLWKNKFK
KEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYDCVCVMFASIPDFKEF
YTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEH
AQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYD
IWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNTE
MSRSLSQSNLAS
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgggctacttgttcatgtgttttggaggcaccgtctctccctgggaccaggtgtcattc
ttcctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagatgccatc
atcgccagtgtcctcacctcctcttcccacaccgtcgtgctgagcgtctgcctgtctgca
atgccgggggccaaggagcacctggtctggcagatcctggccaacgtgatcatcttcatc
tgcgggaacctggccggggcgtaccataagcacctcatggaactcgctctgcagcaaacg
tatcaggacacttgcaactgcatcaagtcgcggatcaagttggaatttgaaaagcgtcag
caggagcggcttctgctgtccctgctgccagcgcacatagccatggagatgaaagccgag
atcatccagaggctgcagggccccaaagccggccaaatggaaaacaccaacaactttcac
aacctgtacgtcaagcggcacaccaacgtcagtatcctctatgcggacatcgttgggttc
acccgtctggccagtgactgctccccaggagaactggtccacatgctgaacgaactcttt
ggaaaatttgatcaaattgcaaaggagaatgaatgcatgagaataaaaattctaggagac
tgctactactgtgtttccggactccctatctctctccctaaccatgccaagaattgtgtg
aaaatgggactggatatgtgtgaagccataaagaaagtgagggacgccactggagtggac
atcaacatgcgcgtgggagtgcattctgggaacgtcctctgcggcgtgatcgggctgcag
aagtggcagtacgacgtatggtcccatgacgttaccctggccaaccacatggaagctgga
ggggtccccggacgtgttcacatttcttccgtcaccctggaacacttgaatggggcttat
aaagtggaggaaggagatggtgatatcagagacccatatttaaagcagcacttggtgaag
acctactttgtaatcaaccccaagggagaacgacggagcccccagcacctcttcagacct
cgacccaccctcgatggagccaagatgagggcttctgtccgcatgacccggtacctggag
tcctggggggcggccaagccctttgcacacctgcatcacagagacagcatgaccacggag
aacggcaagatcagcaccacggatgtaccaatgggtcagcataattttcaaagtcgcacc
ttaagaaccaagtcacaaaagaaaagatttgaagaggaattaaatgaaaggatgattcaa
gcaattgatggaatcaatgcacaaaagcagtggctcaagtctgaagacattcagagaatc
tcattgcttttctacaataaaatactagaaaaagaataccgagccactgcactgccagcc
ttcaagtattacgtgacctgcgcttgcctcatattcttctgcatcttcatcgtgcagatc
ctggtcttacccaaaacgtccattctcgggatttcctttggagctgcatttctctcgctt
gcctttatccttttcgtctgctttgctggacagcttttgcaatgcagcaaaaaagcgtcc
gcctctctcctgtggcttttgaagtcgtcgggcatcatcgccacccgcccctggcctcgg
atctccctgacggtcatcaccacagccatcatattaaccatggccgtgttcaacatgttt
ttcctgagtgagtcagaggagacaattcttccaaccgccaatgcgtcaaacacaagtctt
tctgccttatataatcaggtagcaattctgcgtgcgcaaaatttgtttttcctgccgtac
tttatatacagctgcatcctgggattgatatcctgttcggttttcctgcgcgtgaattac
gagctaaagatgctgatcatgatggcggcattggtgggctacaacaccatctttctccac
actcacgcccacctcctggatgactacagccaggtcttatttgagagaccaggcatttgg
aaagacctaaagaccatgggctcagtgtctctctttatatttttcatcacactgcttgtt
ctgggcagacagaatgaatattactgtaggttagacttcttatggaagaacaagttcaaa
aaagagcgagaggagatagaaaccatggagaacttgaaccgcgtgctgctggagaacgtg
ctccctgcacacgtggctgagcacttcctggccaggagcctgaagaatgaggatttatac
caccagtcctatgactgtgtctgtgtcatgtttgcctccattccggatttcaaagaattc
tatacagaatcggatgtgaacaaggagggcttggaatgccttcggctcctgaacgagatc
atcgccgactttgacgatctgctgtccaagccaaagttcagtggagttgaaaagatcaag
accatcggcagcacgtacatggcggcgacgggtctgagtgccgtgcccagccaggagcac
gcccaggagcccgagaggcagtacatgcacatcggcaccatggtggagtttgcattcgcc
ctggtggggaaactggacgccatcaacaagcactccttcaacgacttcaagttacgagta
ggtattaaccatggccctgtaatagccggcgtgatcggagctcagaagccacagtacgat
atctggggcaacaccgtgaatgtggccagtaggatggacagcaccggggtcctggacaaa
atccaggttactgaggagacgagcctcattctgcagaccctgggatacacgtgcacatgt
cgaggaataatcaatgtgaaaggaaagggggacctgaagacgtactttgtgaacacagag
atgtcacggtccctttcccagagcaacctggcatcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020845
Entry
103020845         CDS       T03086                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04740  Olfactory transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103020845 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103020845 (ADCY3)
   04371 Apelin signaling pathway
    103020845 (ADCY3)
   04020 Calcium signaling pathway
    103020845 (ADCY3)
   04072 Phospholipase D signaling pathway
    103020845 (ADCY3)
   04024 cAMP signaling pathway
    103020845 (ADCY3)
   04022 cGMP-PKG signaling pathway
    103020845 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103020845 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103020845 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103020845 (ADCY3)
   04062 Chemokine signaling pathway
    103020845 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    103020845 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    103020845 (ADCY3)
   04912 GnRH signaling pathway
    103020845 (ADCY3)
   04913 Ovarian steroidogenesis
    103020845 (ADCY3)
   04915 Estrogen signaling pathway
    103020845 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    103020845 (ADCY3)
   04921 Oxytocin signaling pathway
    103020845 (ADCY3)
   04926 Relaxin signaling pathway
    103020845 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    103020845 (ADCY3)
   04918 Thyroid hormone synthesis
    103020845 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    103020845 (ADCY3)
   04916 Melanogenesis
    103020845 (ADCY3)
   04925 Aldosterone synthesis and secretion
    103020845 (ADCY3)
   04927 Cortisol synthesis and secretion
    103020845 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103020845 (ADCY3)
   04270 Vascular smooth muscle contraction
    103020845 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    103020845 (ADCY3)
   04971 Gastric acid secretion
    103020845 (ADCY3)
   04972 Pancreatic secretion
    103020845 (ADCY3)
   04976 Bile secretion
    103020845 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103020845 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103020845 (ADCY3)
   04727 GABAergic synapse
    103020845 (ADCY3)
   04725 Cholinergic synapse
    103020845 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    103020845 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    103020845 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    103020845 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    103020845 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    103020845 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103020845 (ADCY3)
   04714 Thermogenesis
    103020845 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020845 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    103020845 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103020845 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103020845 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103020845 (ADCY3)
   05163 Human cytomegalovirus infection
    103020845 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103020845 (ADCY3)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103020845 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 103020845
NCBI-ProteinID: XP_007191315
UniProt: A0A384AVA4
LinkDB
Position
Un
AA seq 1200 aa
MPRTQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGVGLVLDII
LFALCRKGLLPTRVTRKVVPYVLWLLITAQVFCYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQRDGLKAMQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKRTAAQNGLSGSALPNGAPPSSKPGSPALIETKEPDGSIHT
SGSTSEGPEEPDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDREMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEVLLLLLTVCSLAAIFPRAFPKKIVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYMGPTNGTSGVQIEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIYAWRPIFDEYDRRRFQEHDFPMVALEKMQVLSSPGLNGTDRLPLVPSK
CSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGREKPATFPNGSSVTLPHQR
GHGRREQECTRGATRLLPSCPAGSTGGAALFTMRAGSCSAPRLELGSSAFHSEDLLASVV
NT seq 3603 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgatcctgagtactcggccgagtactcagccgagtac
tccgtcagcctgccctctgaccctgaccgcggggtgggccggacccatgagatctctgtc
cggaactcgggatcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagacgctgctcgtg
ctggtggtcttcgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtcttc
tccagtgacaaactggctccccttgccgtggccggggtcgggctggtgttggacatcatc
ctctttgcgctctgcagaaaggggctgctccccacccgggtcacccggaaagtggtgccc
tacgtgctgtggctgctgataacagcccaggtcttctgctacctgggcctgaacttctcc
cgcgcccatgcagccagcgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtcatcatctctgtggtctcctgcgtcgtg
cacacgctcgtcttgggggtcaccgtggcccagcagcagcgggacgggctgaaggcgatg
cagttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggcagatgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatt
ctctttgccgacatcgtgggcttcacccagctgtcttcagcctgcagcgcccaagagctc
gtgaagctcctcaacgagctctttgcccgcttcgacaagctggcggccaaataccaccag
ctgcggattaagattctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtacgggagaagacgaagaccggggtggacatgcgagtcggggtgcacacgggcaccgtg
ctggggggtgtcctgggccagaagcgctggcagtacgatgtgtggtccaccgatgtcacc
gtggccaacaagatggaggccggcggcatccccgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggcgagttcgatgtggagccaggcgacgggggcagccgctgtgat
tacctggatgagaagggcatcgaaacctacctcatcattgcgtccaagccagaggtgaag
aggacagccgcccaaaatggcctcagtggctcagctctgccgaacggagcgccaccttcc
tcgaagcccggctccccagcgctcattgagaccaaggagcccgacgggagcatccacacc
agcggctccacgtccgaggggcccgaggagcccgatgcccaggctgacaacccctcattc
cccaaccctcgccggaggctgcggcttcaggacctggccgatcgcgtggtggacgcctcc
gaggacgagcacgagctcaaccagctgctcaacgaggccctgctggagcgggagtccgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccgcgagatg
gaaacccgctactcggtggagaaggagaagcagagcggggccgccttcagctgctcctgc
gtcgtcctgctctgtacggccctggttgagattctcatcgacccctggctgatgacaaac
tacgtgacctttgtggttggcgaggtcctgctcctgctcctgaccgtctgctcactggct
gccatctttcctcgggcctttcctaagaagatcgtggccttctcgacttggatcgaccgg
acgcgctgggccaggaacacctgggccatgcttgccatcttcattctggtcatggcgaat
gtcgtggacatgcttagctgtctccagtactacatgggacccaccaacggcacctcaggg
gtgcagatagaggacggctgcgtggagaaccccaagtattacaactacgtcgctgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctgacactcatg
ctgctcatcgcaggggctgtggccgtcatcaacatctacgcctggcgccccatctttgat
gaatacgaccgcagacgcttccaggaacacgactttccgatggtggccttagagaagatg
caggtactttccagccctgggctcaatggcactgacaggctgcccctggtgccttctaag
tgctccatgacggtgatgatctttgtcatgatgctgagcttttactacttctcccgccac
gtggagaagctggcacggacactgttcttatggaagattgaggtccacgaccagaaggaa
cgtgtctatgaaatgagacgttggaacgaggccttggtcactaacatgttgcctgagcac
gtggcccgccattttctggggtccaagaagagagacgaggagctctacagtcagtcttat
gacgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaataacggtggcattgagtgtctgcgcttcctcaatgagatcatctcagatttt
gactctctcctggacaatcccaagtttcgggtcatcaccaagatcaaaaccattggcagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaacggctttaccagctcc
aacaaggagaagtcagacaaggagcgctggcagcacctggcagatctggccgacttcgcg
ctcgccatgaaagacacgctcaccaatatcaacaaccagtccttcaacaacttcatgttg
cgcattggcatgaacaaaggaggggtactggctggcgtcatcggagcccggaagccacac
tacgacatctggggcaatacagtcaacgtagccagcaggatggagtccacaggggtcatg
ggcaacattcaggtggtggaagaaactcaagtcatccttcgagagtatggcttccgcttt
gtgaggagagggcccatctttgtgaaagggaagggggagctgctaaccttcttcttgaag
gggcgagagaagccagccacgttccctaatggctcctcggttacactgccccaccagaga
ggccatggccgccgtgagcaggaatgtaccagaggagcaacaaggctgctgccttcgtgc
ccggcggggagcacaggtggcgcagctctgtttaccatgagggctggcagctgctctgct
ccccggctagaacttggaagcagcgcttttcactctgaagacctgcttgcctctgtggtc
tga

DBGET integrated database retrieval system