KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998016
Entry
102998016         CDS       T03086                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04144  Endocytosis
bacu04151  PI3K-Akt signaling pathway
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04630  JAK-STAT signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05163  Human cytomegalovirus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102998016 (PDGFRA)
   04014 Ras signaling pathway
    102998016 (PDGFRA)
   04015 Rap1 signaling pathway
    102998016 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102998016 (PDGFRA)
   04020 Calcium signaling pathway
    102998016 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102998016 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102998016 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102998016 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102998016 (PDGFRA)
   04540 Gap junction
    102998016 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102998016 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102998016 (PDGFRA)
   05206 MicroRNAs in cancer
    102998016 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102998016 (PDGFRA)
   05231 Choline metabolism in cancer
    102998016 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102998016 (PDGFRA)
   05218 Melanoma
    102998016 (PDGFRA)
   05215 Prostate cancer
    102998016 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102998016 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102998016 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    102998016 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bacu04090]
    102998016 (PDGFRA)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102998016 (PDGFRA)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102998016 (PDGFRA)
CD molecules [BR:bacu04090]
 Proteins
  102998016 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 102998016
NCBI-ProteinID: XP_007168481
UniProt: A0A383Z0A5
LinkDB
Position
Un
AA seq 1089 aa
MGTSHWALLVLGCLLTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQLEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVILLSSDGVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKAGESIVVTCAVFNN
EVVDLQWTYPGQVKGKGITMLEETKVPSIKLVYTLMVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVNLHEVKHFVVDVQAYPPPRIAWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEVHPRD
RSMVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcctcacagggccgagcctc
atcctctgccagctttcattaccctccatcctgcccaatgaaaacgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacggtgctggaagtggtcagtgcctcggcggcccacacagggctgtacacttgc
tattacaaccacacgcagttggaagaaagtgagatcgagggcagacgcatttacatctat
gtgccagacccagatgtcgccttcgtacctctaggaatgacagattacttggtcatcgtg
gaggacgatgattctgccattattccttgtcgaacgactgatcctgagacaccagtgatc
ttactcagcagtgacggggtggtgcacgcctcctatgacagcagacaaggctttaatgga
accttcactgtcggaccctatatctgcgaggccaccgtcagggggaagaagttccagacc
atcccattcaatgtttatgctttaaaagcaacatcagaacttgatctggaaatggaagct
cttaaaactgtatataaggcaggggaatcgattgtggtcacctgtgccgtctttaacaat
gaggttgtggaccttcagtggacttaccctggacaagtgaaaggcaaaggcatcacaatg
ctggaggaaaccaaggtcccgtccatcaagttggtgtacactctgatggtccccgaggcc
acggtgaaagatagcggagattacgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatttctgtgcatgagaaagggtttattgaaatcaaacccaac
ttcagcccgttggaagctgtcaacctgcatgaagtcaaacattttgtggtggacgtgcag
gcctacccccctcccaggatagcctggctgaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgagctaaggaagaagacagcggccattatactattgtagttcaaaatgaagac
gatgtgaagagctatacttttgaactcttaactcaagttccgtcatccattctggacttg
gtcgacgaccaccatggctctaatgggggccagacagtgagatgcacagctgaaggaacc
cctcttcctgatattgagtggatgatttgcaaagatattaagaaatgtaataacgaaact
tcatggacgattttggccaacaatgtctcaaacatcatcacggaggtccacccccgagac
aggagcatggtggagggccaagtgacattcgccaaagtggaggagaccattgcagtccga
tgcctggctaagaatctcctcggggtggagagccgagaactgaagttggtggctcccact
ctgcgttctgaactcacggtggcggccgcagtcttggtgttgctggtgatcgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccaaggtatgaaattcgttggagg
gtcattgaatcaatcagccccgatggacatgaatatatttatgtggacccgatgcaactg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctgggc
tctggcgcatttgggaaagtggttgaaggaactgcctatggattaagtcggtcccaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccgcatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatctggtcaactatttgcataagaatagggacagcttcttgagccgccacccagagaag
ccaaagaaagagctggacatttttggattgaaccctgctgacgaaagcacacgaagttac
gttattttatcttttgaaaataacggtgactacatggacatgaagcaagctgacactaca
cagtatgtccccatgctggaaaggaaagaggtttctaagtactcagacatccagagagcg
ctgtacgatcgcccagcctcatataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttgagctttacgtat
caagttgcccgaggaatggagtttttggcttcgaaaaattgtgtccaccgggacctggcc
gctcgcaatgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtcaaaaggcagcacctttctcccggtgaag
tggatggctcccgagagcatcttcgacaacctctacaccacactgagcgacgtctggtct
tacggcattctgctctgggagatcttttccctcggtggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggacttcctgaagagtgaccatcccgccgtggcacgtatg
cgcgttgactccgacaacgcctacattggcgtcacctacaagaacgaggaggacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagcgcggacagtggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaagacctgggcaaaaggaacagacac
agctcgcagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggacctggtggaagacagcttcctgtaa

DBGET integrated database retrieval system