KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998079
Entry
102998079         CDS       T03086                                 

Gene name
GABARAPL2
Definition
(RefSeq) GABA type A receptor associated protein like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04136  Autophagy - other
bacu04137  Mitophagy - animal
bacu04140  Autophagy - animal
bacu04371  Apelin signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04727  GABAergic synapse
bacu05014  Amyotrophic lateral sclerosis
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102998079 (GABARAPL2)
   04068 FoxO signaling pathway
    102998079 (GABARAPL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102998079 (GABARAPL2)
   04136 Autophagy - other
    102998079 (GABARAPL2)
   04137 Mitophagy - animal
    102998079 (GABARAPL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102998079 (GABARAPL2)
  09156 Nervous system
   04727 GABAergic synapse
    102998079 (GABARAPL2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102998079 (GABARAPL2)
   05022 Pathways of neurodegeneration - multiple diseases
    102998079 (GABARAPL2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102998079 (GABARAPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    102998079 (GABARAPL2)
   04121 Ubiquitin system [BR:bacu04121]
    102998079 (GABARAPL2)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    102998079 (GABARAPL2)
Membrane trafficking [BR:bacu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    102998079 (GABARAPL2)
Ubiquitin system [BR:bacu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   102998079 (GABARAPL2)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102998079 (GABARAPL2)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 102998079
NCBI-ProteinID: XP_007182670
UniProt: A0A384A5M6
LinkDB
Position
Un
AA seq 117 aa
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagtggatgttcaaggaggaccactcgctggaacacagatgcgtggaatctgcgaag
atccgagcgaaatatcccgaccgggttccggtgattgtggaaaaagtctcaggctctcag
attgttgacattgacaaacggaagtatctggttccatctgacatcactgtggctcagttc
atgtggatcatcaggaaaaggatccagcttccttctgaaaaggcaatattcctgtttgtg
gataagacagtcccacagtccagcctaactatgggacagctttacgagaaggaaaaagat
gaagatggattcttgtatgtggcctacagtggagaaaacacttttggcttctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999754
Entry
102999754         CDS       T03086                                 

Gene name
GABARAP
Definition
(RefSeq) GABA type A receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04136  Autophagy - other
bacu04137  Mitophagy - animal
bacu04140  Autophagy - animal
bacu04371  Apelin signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04727  GABAergic synapse
bacu05014  Amyotrophic lateral sclerosis
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102999754 (GABARAP)
   04068 FoxO signaling pathway
    102999754 (GABARAP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102999754 (GABARAP)
   04136 Autophagy - other
    102999754 (GABARAP)
   04137 Mitophagy - animal
    102999754 (GABARAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102999754 (GABARAP)
  09156 Nervous system
   04727 GABAergic synapse
    102999754 (GABARAP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102999754 (GABARAP)
   05022 Pathways of neurodegeneration - multiple diseases
    102999754 (GABARAP)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999754 (GABARAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    102999754 (GABARAP)
   04121 Ubiquitin system [BR:bacu04121]
    102999754 (GABARAP)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    102999754 (GABARAP)
Membrane trafficking [BR:bacu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    102999754 (GABARAP)
Ubiquitin system [BR:bacu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   102999754 (GABARAP)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102999754 (GABARAP)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 102999754
NCBI-ProteinID: XP_007166523
UniProt: A0A383YUH8
LinkDB
Position
Un
AA seq 117 aa
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtataaagaggagcatccgttcgagaagcgccgctctgagggcgagaag
atccgaaagaaatacccggaccgggtcccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatatctggtgccttctgatcttacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacgatgggtcagctataccaggaacaccatgaa
gaagacttctttctatacattgcctacagtgacgaaagtgtctatggtctgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008527
Entry
103008527         CDS       T03086                                 

Gene name
GABARAPL1
Definition
(RefSeq) GABA type A receptor associated protein like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04136  Autophagy - other
bacu04137  Mitophagy - animal
bacu04140  Autophagy - animal
bacu04371  Apelin signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04727  GABAergic synapse
bacu05014  Amyotrophic lateral sclerosis
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103008527 (GABARAPL1)
   04068 FoxO signaling pathway
    103008527 (GABARAPL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103008527 (GABARAPL1)
   04136 Autophagy - other
    103008527 (GABARAPL1)
   04137 Mitophagy - animal
    103008527 (GABARAPL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103008527 (GABARAPL1)
  09156 Nervous system
   04727 GABAergic synapse
    103008527 (GABARAPL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103008527 (GABARAPL1)
   05022 Pathways of neurodegeneration - multiple diseases
    103008527 (GABARAPL1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008527 (GABARAPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103008527 (GABARAPL1)
   04121 Ubiquitin system [BR:bacu04121]
    103008527 (GABARAPL1)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103008527 (GABARAPL1)
Membrane trafficking [BR:bacu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    103008527 (GABARAPL1)
Ubiquitin system [BR:bacu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   103008527 (GABARAPL1)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    103008527 (GABARAPL1)
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 103008527
NCBI-ProteinID: XP_007196139
UniProt: A0A384BA19
LinkDB
Position
Un
AA seq 117 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttccagtataaggaggaccatccctttgagtatcggaaaaaggaaggagaaaag
atccggaagaaatatccggaccgggtccctgtgatcgtggagaaggctcccaaggccagg
gtgcctgatctggacaagaggaagtacctagtgccctctgacctcactgttggccagttc
tacttcttaatccggaagaggatccacctgagacccgaagacgccttattcttctttgtc
aacaacaccatccctcccactagcgcgaccatgggccagctgtatgaggacaaccacgag
gaagactattttctgtacgtggcctacagtgacgagagcgtctacgggaagtga

DBGET integrated database retrieval system