KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998082
Entry
102998082         CDS       T03086                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04217  Necroptosis
bacu04380  Osteoclast differentiation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102998082 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    102998082 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102998082 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102998082 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102998082 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    102998082 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    102998082 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102998082 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102998082 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102998082 (IFNAR1)
   05160 Hepatitis C
    102998082 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    102998082 (IFNAR1)
   05164 Influenza A
    102998082 (IFNAR1)
   05162 Measles
    102998082 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    102998082 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102998082 (IFNAR1)
   05169 Epstein-Barr virus infection
    102998082 (IFNAR1)
   05165 Human papillomavirus infection
    102998082 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bacu04050]
    102998082 (IFNAR1)
Cytokine receptors [BR:bacu04050]
 Interleukin receptor families
  IFN receptor family
   102998082 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 102998082
NCBI-ProteinID: XP_007183770
UniProt: A0A384A8U0
LinkDB
Position
Un
AA seq 562 aa
MLALLGATTLMLVAGAPWVLPAASGGTNLKSPENGRVCIIDDNFILKWNSNSESVRNVTF
SAEYKIPGMDNWKKLPGCQHITSTECNFSSVKLKNVYEKIELRIRAEKGNNTSQWHEVKP
FIPFQKAQIGPLDVHLEAEDKAIIINISPPGTKDSIMWAMDHSSFMYSLVIWKNSSRLEE
RTETVYSRDKIYKLSPETTYCLKVKAELRSPRRVGLYSPVYCINTTEKHKVPAPENIQID
AENQVYVLKWDYAYENTTFRAQWSHEFLKRIPGSHSDKWKQIPNCEDVKTTHCVIPQNVF
PEGIHRIRVQASNGNNTSFWSEEKIFNTEMKTIIFPPVISMKSINDDSLHVSIGAPKESE
NKSVNQLYPLIYEVIFRENTSNAERKVVEKRTDFTFPNLKPLTVYCVKARALTENDKWNK
SSVFSDTVCEKTKPGNTSKTWLIAGICTSLFSIIVAIYVVKVLLRCINYVFFPSSKPPST
VDEYFSEPPVRNLLLSTSEERTERCSIIENANTLTVIEETNPIDEDHKKYNSQTSQDSGN
YSNEDENSGSKISEELLQQETV
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgctcgcgctcctgggcgcgacgaccctgatgctggtcgctggggcgccgtgggtgttg
cccgcagcctcagggggaacaaatctaaaatctcctgaaaatggcagggtctgcatcatt
gatgacaactttatcctgaagtggaacagcaacagtgagtctgtcaggaatgtgactttt
tcagcagagtataaaataccagggatggataattggaaaaaattgcctgggtgtcaacat
attactagtaccgaatgcaacttttcttcagtcaagcttaaaaatgtttatgaaaaaatc
gaattgcgcataagagcagaaaaaggaaacaacacttctcaatggcatgaggttaagcca
tttataccatttcaaaaagctcagattggtcctctagatgtacatttagaagctgaagat
aaggcaataataataaacatctctcctcctgggacaaaagatagtatcatgtgggctatg
gatcattccagctttatgtatagcttagttatctggaaaaactcttcaaggctagaagaa
aggactgaaactgtttattccagagataaaatttataaactctcaccagagactacttat
tgtttaaaagttaaagcagaactacgttcaccaagaagagttggtctctatagtccagtg
tattgtataaacaccacagagaaacataaagtgcctgcaccagaaaatatacaaatcgat
gctgaaaatcaggtctatgttcttaagtgggattacgcatatgaaaacacgacttttcga
gctcagtggtcccatgagtttttaaaaaggattcctgggagtcattcagacaaatggaaa
caaataccaaactgtgaagatgtcaaaactacccactgtgtgattcctcaaaatgttttc
ccagaaggaattcaccgtatccgtgtccaagcatctaatggaaataacacatctttttgg
tctgaagagaaaatatttaatactgaaatgaaaactataatatttcctccagtcattagc
atgaaatccattaatgatgactcactgcacgtctctatcggtgctccaaaagagtctgaa
aacaagtctgtgaaccagctttacccactaatttatgaagttatttttcgggaaaacact
tcaaatgctgagagaaaagttgtagagaaaagaactgattttacctttcctaacttgaaa
ccgctgactgtatactgtgtgaaagccagagcactcactgagaatgacaagtggaataaa
agcagtgtttttagtgatactgtgtgtgagaaaacaaaaccaggaaatacttccaaaacc
tggcttatagctggaatttgcacttcattattttctatcattgttgccatttatgttgtg
aaagtcctcttgagatgtatcaattatgtgttctttccatcaagtaaacctccttccact
gtagatgagtatttctctgaaccgccagtaaggaatctactcctttccacttctgaggaa
cgaacagaaagatgttctataattgaaaatgcaaacactcttactgtaatagaagagact
aatccaattgatgaagatcacaaaaagtacaattcccaaactagtcaagattcaggaaac
tattctaatgaagacgaaaacagtggaagtaaaataagtgaagaacttctgcaacaggaa
actgtgtga

DBGET integrated database retrieval system