KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998097
Entry
102998097         CDS       T03086                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04115  p53 signaling pathway
bacu04218  Cellular senescence
bacu04935  Growth hormone synthesis, secretion and action
bacu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102998097 (IGFBP3)
   04218 Cellular senescence
    102998097 (IGFBP3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102998097 (IGFBP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102998097 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    102998097 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    102998097 (IGFBP3)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    102998097 (IGFBP3)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102998097 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 TIMELESS_C
Other DBs
NCBI-GeneID: 102998097
NCBI-ProteinID: XP_007187746
UniProt: A0A384AK46
LinkDB
Position
Un
AA seq 146 aa
MGSTENQALSGTHRVPDSKFHPVHTKMDVIKKGHAKDSQRYKVDYESQSTDTQNFSSESK
RETEYGPCRREMEDTLNHLKFLNMLSPRGIHIPNCDKKGFYKKKQCRPSKGRKRGFCWCV
DKYGQPLPGFDVKGKGDVHCYSMESK
NT seq 441 nt   +upstreamnt  +downstreamnt
atggggagcacagagaaccaggccctgagcggcacgcacagggtgcccgactccaaattc
caccccgtccacaccaagatggacgtcatcaagaaaggacacgccaaggacagccagcgc
tacaaggtcgactatgagtctcagagcacagacacccagaacttctcctccgagtccaag
cgtgagacggaatacgggccctgccgccgggagatggaggacacgctgaaccatctcaag
ttcctgaacatgctcagccccaggggtatccacattcccaactgcgacaagaagggcttc
tacaagaaaaagcagtgccgcccttccaaaggcaggaagcggggcttctgctggtgcgtg
gataagtacgggcagcccctcccgggcttcgacgtgaaggggaaaggggacgtgcactgc
tacagcatggagagcaagtaa

DBGET integrated database retrieval system