KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998170
Entry
102998170         CDS       T03086                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04340  Hedgehog signaling pathway
bacu04360  Axon guidance
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102998170 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    102998170 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102998170 (SHH)
   05205 Proteoglycans in cancer
    102998170 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    102998170 (SHH)
   05217 Basal cell carcinoma
    102998170 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bacu01002]
    102998170 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    102998170 (SHH)
Peptidases and inhibitors [BR:bacu01002]
 Cysteine peptidases
  Family C46: hedgehog family
   102998170 (SHH)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   102998170 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 102998170
NCBI-ProteinID: XP_007165551
LinkDB
Position
Un
AA seq 352 aa
MDEMLLLARCLLVVLVSSLLMCSGLACGPGRGFGKRRNPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDEGRLLYSD
FLTFLDRDHSAKKVFYAIETREPREHLLLTAAHLLFVAPHNGSAVREPEALSWSSFCGRP
GASALCQPGQGDRSSVPDAVSQAQPRWAVTEAFGLVKAAVPLCALGPNASAG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggacgagatgctactgctggcgagatgtctgctggtggtgctggtctcctcgctgctg
atgtgctcggggctggcgtgcggacccggccggggatttgggaagaggcggaacccaaaa
aaactgacccctttagcctacaagcagttcatccccaacgtggctgagaagaccctaggg
gccagtggaagatatgaagggaagatcacgagaaactcggagcgatttaaggaactcacc
cccaattacaaccctgacatcatatttaaggatgaagaaaacactggagcggaccggctg
atgactcagcggtgcaaggacaagttgaacgccttagccatctccgtgatgaaccagtgg
ccaggagtgaagctgcgggtgacagagggctgggacgaggatggccaccactcagaagag
tcgctgcactacgagggccgcgccgtggacatcaccacctcggaccgcgaccgcagcaag
tacggcatgctggcacgcctggccgtggaggccggcttcgactgggtctactacgagtcc
aaagcgcacatccactgctcggtgaaagcagagaactcggtggcggccaaatcgggcggc
tgcttcccgggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggac
ctgcgccccggggaccgcgtgctggcggccgacgacgagggccggctgctctacagcgac
ttcctcaccttcctggaccgcgaccacagcgccaagaaggtcttctacgcgatcgagacg
cgggagcctcgcgagcacctgctgctcaccgccgcgcacctgctcttcgtcgcgccgcac
aacggctcggccgtccgggagcccgaggcgctgtcgtggtcctccttctgcgggcgccct
ggggccagcgccctgtgtcagccgggccagggggacaggtcctccgtgcctgatgcggtg
tcacaggctcagccgcgctgggcggtcactgaggcctttggtttagtgaaggctgctgtc
ccgctttgcgccctgggcccaaatgcctctgcaggctga

DBGET integrated database retrieval system