KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998249
Entry
102998249         CDS       T03086                                 

Gene name
ELK1
Definition
(RefSeq) ELK1, ETS transcription factor
  KO
K04375  ETS domain-containing protein Elk-1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04510  Focal adhesion
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04921  Oxytocin signaling pathway
bacu05140  Leishmaniasis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05213  Endometrial cancer
bacu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102998249 (ELK1)
   04012 ErbB signaling pathway
    102998249 (ELK1)
   04014 Ras signaling pathway
    102998249 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102998249 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102998249 (ELK1)
   04912 GnRH signaling pathway
    102998249 (ELK1)
   04921 Oxytocin signaling pathway
    102998249 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102998249 (ELK1)
   05205 Proteoglycans in cancer
    102998249 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102998249 (ELK1)
   05213 Endometrial cancer
    102998249 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102998249 (ELK1)
   05161 Hepatitis B
    102998249 (ELK1)
   05163 Human cytomegalovirus infection
    102998249 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102998249 (ELK1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    102998249 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 102998249
NCBI-ProteinID: XP_007180334
UniProt: A0A383ZYY2
LinkDB
Position
Un
AA seq 437 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGQSKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTVANVGTTAVH
AVPGDTASGKPGTPKGAGVAGPGGLARSSRNDYMRSGLYSTFTIQSLQPQPQPPSHPRPS
TVLPSTAPAGAAVPPSASPSPVEACLEAEEAGLPLQVILTPPEAPNLKSEEPNMEPGLGR
PLPPEVKVEEPKEELEAAATGEAGFVLEAVKAEPFEPKAEPEAPPAEGVPARLPAVVMET
AAVGGLAASTTSSTEIAQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPA
LTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSIS
VDGLSTPVVLSPGPQKP
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggacccttctgtgacgctgtggcagtttctgctgcagctgttgagagagcaaggcaat
ggccacatcatctcctggacctcccgggatggcggtgagttcaagctggtggatgctgag
gaggtggcccggctctgggggcagagcaagaataagaccaacatgaattatgacaagctc
agccgggccttgcggtactactatgataagaacatcatccgcaaagtgagtggccagaag
ttcgtctacaagtttgtgtcctaccccgaggtcgcggggtgctccactgaggactgcccg
ccccagcctgaggtgtctgtcacctccactgtggcaaatgtgggcaccacagctgtacac
gccgtccccggggacactgcctctgggaagccaggcacacccaagggtgcaggagtggca
ggcccaggtggcttggcgcgcagcagccggaacgattacatgcgctcgggcctctattcc
accttcaccatccagtccctgcagccgcagccgcagccgccctctcatcctcggccttcc
acagtgctccccagcaccgcccctgcaggagcagcagtgcccccctcggccagtccaagc
cctgtggaggcctgcctggaggctgaggaggccggcctgcctctgcaggtcatcctgacc
ccacccgaggccccaaaccttaaatccgaagagccaaatatggagcctgggttgggccgg
ccactccccccagaagtcaaagtggaagagcccaaggaagagttagaagccgcagccact
ggggaggcggggtttgtcctggaagccgtcaaggccgagccctttgagcccaaggccgag
ccagaagcccctcccgcggagggcgtgccagcccggctgcccgcggtcgttatggaaact
gcggcggtgggcggccttgcggcttccacaacttccagcacggagatcgcccagcctcag
aagggccggaagccccgcgacctggagcttccactcagcccgagcttgctgggtgggccg
ggacccgaacggactccgggatcgggaactggttccggtctgcaggcgccaggcccagcg
ctgacgccttccctgctacctacgcacacattgaccccggtgctgctgacgcccagctcg
ctgccccccagcattcacttctggagcaccctgagtcccattgcaccccgtagcccggcc
aagctctccttccagtttccgtccagtggcagcgcccaggtgcacatcccttccatcagc
gtggatggcctctcaacccccgtggtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system