KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998316
Entry
102998316         CDS       T03086                                 

Gene name
HBEGF
Definition
(RefSeq) heparin binding EGF like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu05171  Coronavirus disease - COVID-19
bacu05205  Proteoglycans in cancer
bacu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102998316 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102998316 (HBEGF)
   04915 Estrogen signaling pathway
    102998316 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    102998316 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102998316 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    102998316 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102998316 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102998316 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    102998316 (HBEGF)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102998316 (HBEGF)
SSDB
Motif
Pfam: RANK_CRD_2 DUF3377
Other DBs
NCBI-GeneID: 102998316
NCBI-ProteinID: XP_007194144
UniProt: A0A384B4A2
LinkDB
Position
Un
AA seq 262 aa
MKLLPSVVLKLFLAAVLSVLVTGDSLERLRRGLAAGTSNLDSPTQSTDQLLPPGGGRGRE
VLDLEETDLDLFRAAFSSKPQALATPSKEERGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCINEHTLGELTPEGRFFISASCPTPDGRSQKETWQSGAPGWSGAPVAFF
PKSCSCHPGYHGERCHGLSLPVKNRLYTYDHTTILVVVVVVLSSVCLLVIVGLLMFWNQL
GTATSEKIQVDHRLCRGEGLHN
NT seq 789 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttctggctgcagtgctctcggtgttg
gtgaccggcgacagcctggagcggcttcggagagggctggcggctggaaccagcaatctg
gactcccctactcaatctacggaccagctgctgcccccgggaggtggccgaggccgggaa
gtcctggacttggaagagacagacctggaccttttcagagctgctttctcttccaagcca
caagctctggccacaccgagcaaggaggagcgtgggaaaagaaagaagaaaggcaagggg
ttagggaagaagagagacccatgtcttcggaaatacaaggacttctgcatccacggagaa
tgcaaatacgtgaaggagctccgggctccatcctgcataaatgagcacacgctaggagag
ctgacacctgaaggcaggttcttcatttctgcctcatgccctactccagatgggagaagt
cagaaggaaacatggcagagtggggctcctgggtggagtggagctcccgtggccttcttt
cccaagtcctgcagctgccacccgggttaccatggagagaggtgccatgggctgagcctc
ccagtgaagaatcgtttatatacgtatgatcacaccaccatcctggttgtggtggtcgtg
gtgctgtcatccgtctgtctgctggtcatcgtggggcttctcatgttttggaatcagctg
gggactgctacctctgagaagatacaagttgatcacagactctgcagaggggaaggactt
cacaactag

DBGET integrated database retrieval system