KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998345
Entry
102998345         CDS       T03086                                 

Gene name
FZD2
Definition
(RefSeq) frizzled class receptor 2
  KO
K02235  frizzled 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102998345 (FZD2)
   04390 Hippo signaling pathway
    102998345 (FZD2)
   04150 mTOR signaling pathway
    102998345 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102998345 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102998345 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102998345 (FZD2)
   05205 Proteoglycans in cancer
    102998345 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102998345 (FZD2)
   05226 Gastric cancer
    102998345 (FZD2)
   05217 Basal cell carcinoma
    102998345 (FZD2)
   05224 Breast cancer
    102998345 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102998345 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    102998345 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102998345 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102998345 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bacu04030]
    102998345 (FZD2)
G protein-coupled receptors [BR:bacu04030]
 Frizzled / Smoothened family
  102998345 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 102998345
NCBI-ProteinID: XP_007180249
UniProt: A0A383ZZ87
LinkDB
Position
Un
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLSTAPPPGLQPGAGGTP
GGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgtctgctgctgccgctgctgctgctgcccgctgcg
gggccggcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgttgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccatacgaaccaggaggacgcaggactggaggtgcaccagttctacccattggtg
aaggtgcagtgctcgcccgaactgcgcttcttcctgtgctccatgtatgcacccgtgtgc
actgtgctggagcaggccatcccgccgtgccgctcgatctgcgagcgcgcgcgccagggc
tgcgaggcgctcatgaacaagttcggtttccagtggccggagcgccttcgctgcgagcac
ttcccccgccacggcgcggagcagatctgcgtgggccagaaccactcggaggacggcgcg
cccgcgttgctctccaccgcgccgccgccgggcctgcagccgggtgcggggggcaccccg
ggcggcccgggtggcggcggctcgcccccgcgctatgccacgctggagcacccgttccac
tgtccgcgcgtcctcaaggtgccgtcctatctcagctacaagtttctgggcgagcgcgac
tgcgcggctccgtgcgagccggcgcggcccgacggctccatgttcttctcccaggaagag
acgcgctttgcgcgactctggatcctcacctggtccgtgttgtgctgtgcctccaccttt
ttcaccgtcaccacgtacctggtggacatgcagcgcttccgctacccggagcggcccatc
atctttctgtcaggctgctacactatggtgtcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtggtgtgtaacgagcgcttctccgaggacggctaccgtacggtggtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggct
agctccatctggtgggtcatcctgtcgctcacctggttcctggcggcgggcatgaagtgg
ggccacgaggccatcgaggccaactcgcagtacttccacctggccgcgtgggccgtgccc
gccgtcaagaccatcacaatcctggccatgggccagattgacggcgacctgctgagcggc
gtgtgcttcgtgggcctcaacagcctggacccgctgcggggcttcgtgctggcgccgctc
ttcgtgtacctgttcataggcacgtccttcctcctggccggtttcgtgtcactcttccgc
atccgtaccatcatgaagcacgacggcaccaagacggagaagctggagcggctcatggtg
cgcatcggcgtcttctcggtgctgtacacggtgcccgccaccatcgtcatcgcctgctat
ttctacgagcaggccttccgagagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcacccgacttcaccgtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tccggcaagacgctgcactcgtggaggaagttctacacccgtctcaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999603
Entry
102999603         CDS       T03086                                 

Gene name
FZD6
Definition
(RefSeq) frizzled class receptor 6
  KO
K02376  frizzled 6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102999603 (FZD6)
   04390 Hippo signaling pathway
    102999603 (FZD6)
   04150 mTOR signaling pathway
    102999603 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102999603 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102999603 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999603 (FZD6)
   05205 Proteoglycans in cancer
    102999603 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102999603 (FZD6)
   05226 Gastric cancer
    102999603 (FZD6)
   05217 Basal cell carcinoma
    102999603 (FZD6)
   05224 Breast cancer
    102999603 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102999603 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    102999603 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102999603 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102999603 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bacu04030]
    102999603 (FZD6)
G protein-coupled receptors [BR:bacu04030]
 Frizzled / Smoothened family
  102999603 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha
Other DBs
NCBI-GeneID: 102999603
NCBI-ProteinID: XP_007173448
UniProt: A0A383ZE62
LinkDB
Position
Un
AA seq 712 aa
METFTFLWTCMFLPLVRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEL
FLPLANLECSPNVETFLCKAFVPTCTEQVDVVPPCRKFCEKVYSDCKNLMDTFGIRWPEE
LECDRLQYCDESVPVTFDQHTEFLSPHKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNSTACNKADEKLELGDTVVLGSQNKACTVLFMFLYFSTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTIMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRSRKKDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITNHDYLGRETLTEIQTSPETSVREV
RADGVSTSKLREQDCEEPASPAASSSKLCGEQTDGKGRAGNVNDKSSMSESAWSEGRVTP
KSDVTETGPVQSHSLHVPRSSEPSSLKGSTSLLVHSASGVGKEQGTGGHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaacgtttacatttttgtggacatgtatgtttctacccctcgtacgagggcacagt
cttttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatgggtcattatgaccagagtattgcggctgtggaaatggagctt
tttcttcctcttgcaaatctggaatgttcaccaaatgttgaaactttcctttgcaaagct
ttcgtaccaacctgcacagagcaagttgatgtggttccaccctgtcgtaaattttgtgag
aaagtgtattctgactgcaaaaacttaatggacacttttggaatccgatggcctgaggaa
cttgaatgtgacagattacagtactgtgacgagtctgttcctgtaacttttgatcaacac
acagagtttctcagtcctcacaagaaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggctataagtttctgggaattgaccag
tgtgcacctccatgccccaacatgtattttaaaagtgatgagctagagtttgcaaaaagc
tttattggaatagtttcaatattttgtctttgtgcaactctgtttacattccttactttt
ttaattgatgttagaaggttcagataccctgagagaccaattatatattactctgtctgt
tacagcattgtatctcttatgtacttcattggattcttgctaggcaatagcacagcctgc
aataaggcagatgagaaactagaacttggtgacacagttgttctaggctctcaaaataag
gcttgcaccgttttgtttatgtttctgtatttttccacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgctgggagaaaatggagttgtgaagccatt
gaacaaaaagcagtgtggtttcatgctgttgcatggggaataccaggttttctgaccatt
atgcttcttgctatgaacaaagttgaaggggacaatattagtggagtttgctttgtcggc
ctttatgacctggatgcctctcgctactttgtactgttgccactgtgcctttgtgtgttt
gtcgggctctctcttcttttagctggcattatttccttaaatcatgttcgacaagttata
caacatgatggccggaaccaagagaaactaaagaaatttatgattcgaattggagtcttc
agtggcctgtatcttgtgccattagtgacacttcttggatgttacgtctatgagcaagtg
aacaggataacctgggagataacttgggtctctgaccattgtcgtcagtaccacatccca
tgtccttaccaggcaaaaacagaaactcgaccagagttggctttatttatgataaaatat
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaagtcgcaagaaagatccaatcagtgaaagtcga
agagtactacaggagtcgtgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactacaaaccaagttcacataagctgaaggtcatttccaaatccatgggaacc
agcacaggagctacagcaaatcatggcacttctgcagtagcaatcactaaccatgattac
ttaggacgagaaactttgacagaaatacaaacctcaccagaaacatcagtgagagaggtg
agagcagatggagtgagcacctccaaattacgagaacaggactgtgaggaacctgcctcc
ccagcagcatccagttccaaactctgcggggaacagactgacgggaaaggccgggcaggc
aatgtgaatgataagagcagtatgtctgaaagtgcgtggagtgaaggaagggtcactcca
aagagtgatgtcactgaaactggcccggtgcagagccacagcttgcatgttcccaggtct
tcagagccaagcagcctcaaaggctccacatcactgcttgttcactcagcatcaggagtt
ggaaaagagcagggcactggtggtcactcagatacttga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006051
Entry
103006051         CDS       T03086                                 

Gene name
FZD10
Definition
(RefSeq) frizzled class receptor 10
  KO
K02842  frizzled 9/10
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103006051 (FZD10)
   04390 Hippo signaling pathway
    103006051 (FZD10)
   04150 mTOR signaling pathway
    103006051 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103006051 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103006051 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006051 (FZD10)
   05205 Proteoglycans in cancer
    103006051 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103006051 (FZD10)
   05226 Gastric cancer
    103006051 (FZD10)
   05217 Basal cell carcinoma
    103006051 (FZD10)
   05224 Breast cancer
    103006051 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103006051 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    103006051 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103006051 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103006051 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bacu04030]
    103006051 (FZD10)
   04090 CD molecules [BR:bacu04090]
    103006051 (FZD10)
G protein-coupled receptors [BR:bacu04030]
 Frizzled / Smoothened family
  103006051 (FZD10)
CD molecules [BR:bacu04090]
 Proteins
  103006051 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 103006051
NCBI-ProteinID: XP_007198433
UniProt: A0A384BG88
LinkDB
Position
Un
AA seq 579 aa
MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRPMCEQARLKCSPI
MEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSGXKTFRPQRPHSAQEHPL
KDGGPGRAGCDNPGKFRHVEKSASCAPLCTPGVDVYWSRDDKHFAVVWLAVWSVLCFFSS
AFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESVACDRDSGQLYVIQE
GLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIP
AVKTILILVMRRVAGDELTGVCYVGSMDINALTGFVLIPLACYLIIGTSFILSGFVALFH
IRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNVEYWKILATQHKCK
MNNQTKNLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWVWTSKTLQSWQNVCSRRFKKK
SRRKPASVITSSGIYKKAQHPPKTHLGKYEIPAQPPTCV
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgcagcgcccgggcccccgcctgtggctggtccttcaggtgatgggctcgtgcgccgcc
atcagctccatggacatggagcgtccgggcgacggcaagtgccagcccatcgagatcccg
atgtgcaaggacattggctacaacatgacccgcatgcccaacctgatgggccacgagaac
cagcgcgaggccgccatccagctgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgcccatgtgcaccgagcaagtctcc
acccccatccccgcctgccggcccatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactcgctggactgcagcaaactccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaacggctcggacgagcccgcgcgg
ggctcgggcnagaaaacattccggccgcagcggccgcacagcgcgcaggagcacccgctg
aaggacggggggcccgggcgcgccggctgcgacaacccgggcaagttccgccacgtggag
aagagcgcgtcgtgcgcgccgctctgcacgccgggcgtggacgtctactggagccgggac
gacaagcacttcgccgtggtctggctggccgtctggtccgtgctctgcttcttctccagc
gccttcaccgtgctcaccttcctcatcgacccggcgcgcttcaggtaccccgagcgcccc
atcatcttcctctccatgtgctactgcgtctactcggtgggctacatcatccgcctcttc
gcgggcgccgagagcgtcgcctgcgaccgggacagcgggcagctctacgtcatccaggag
gggcttgagagcacgggctgcaccctggtcttcctggtcctctactacttcggcatggcc
agttccctgtggtgggtgattctcacgctcacctggtttctggctgcgggcaagaagtgg
ggccacgaggccatcgaggccaacagcagctacttccacctggccgcctgggccatcccg
gccgtgaagaccatcctaatcctggtgatgcgcagggtcgcgggggacgagctgaccggc
gtctgctacgtggggagcatggacatcaacgccctcaccggcttcgtcctcatcccgctg
gcctgttacctcatcatcggcacttcctttatcctctcgggcttcgtggccctcttccac
atccggagggtgatgaaaacgggtggggagaacacggacaaactggaaaagctcatggtg
aggataggggtcttctccgtgctctacacggtgccggccacctgtgtgattgcctgttac
ttttacgaacgcctcaacgtggagtattggaagatcctggccacgcagcacaagtgcaaa
atgaacaaccagactaaaaacctggactgtctgatggccgcctccatccccgcggtggag
atcttcatggtgaagattttcatgctgctggtggtgggcatcacgagtggcatgtgggtc
tggacatccaagaccctgcagtcctggcagaacgtttgcagccgcaggttcaagaaaaag
agccgaagaaaaccggccagcgtgatcaccagcagtggaatttacaaaaaagcccagcat
cccccaaaaacccatctcgggaaatacgaaatccctgcccagcctcccacctgcgtgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008493
Entry
103008493         CDS       T03086                                 

Gene name
FZD7
Definition
(RefSeq) frizzled class receptor 7
  KO
K02432  frizzled 1/7
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103008493 (FZD7)
   04390 Hippo signaling pathway
    103008493 (FZD7)
   04150 mTOR signaling pathway
    103008493 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103008493 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103008493 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008493 (FZD7)
   05205 Proteoglycans in cancer
    103008493 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103008493 (FZD7)
   05226 Gastric cancer
    103008493 (FZD7)
   05217 Basal cell carcinoma
    103008493 (FZD7)
   05224 Breast cancer
    103008493 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103008493 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    103008493 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103008493 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103008493 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bacu04030]
    103008493 (FZD7)
G protein-coupled receptors [BR:bacu04030]
 Frizzled / Smoothened family
  103008493 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 103008493
NCBI-ProteinID: XP_007190599
UniProt: A0A384ATZ5
LinkDB
Position
Un
AA seq 570 aa
MLGPRAAASRSPLGLCTLVLALLGALPAGAGAQQYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDKAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGSAGGGPTAYP
TAPYMPDLPFTALPPGAADGRGRSPFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHV
AGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLA
AGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGF
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATI
VLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITT
GFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgctgggcccccgcgcggcagcgtcgcgctcgcctctgggcctgtgtaccctggtgctt
gcgctgctgggcgcactgcccgcgggcgccggggcgcagcagtatcacggcgagaagggc
atctcagtaccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggtcacacgaaccaagaggatgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgagctgcgcttc
ttcctgtgctccatgtacgcacccgtgtgtaccgtgctcgataaggccatcccgccgtgc
cgctccctgtgcgagcgtgcccgccagggctgtgaggcgctcatgaacaagttcggcttc
caatggcctgagcggctgcgttgcgagaacttccccgtgcacggcgccggagagatctgc
gtgggccagaacacttcggacggctccggcagcgcgggcggcggccccaccgcctatccc
accgcgccctacatgcccgacctgcccttcaccgcgctgcctccgggggccgctgacggt
aggggccgctcccccttccccttctcgtgcccacgccagctcaaggtacccccctacctc
ggctaccgtttcctgggcgagcgcgactgcggcgccccttgcgagccgggccgcgccaac
ggcctcatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tcagtgctgtgctgcgcctccgtgcttacctacctagtggacatgcggcgcttcagctac
ccggagcggcccatcatcttcctatcgggctgctatttcatggtggccgtggcgcacgtg
gccggcttcctgttggaggaccgcgcggtgtgcgtggagcgcttttcagacgacggctac
cgcacggtggcgcagggcaccaagaaggaaggctgcaccattctcttcatggtgctctac
ttcttcggcatggccagttccatctggtgggtcatcctgtcgctcacctggttcctggcg
gccggcatgaagtggggccacgaggccatcgaggccaattcgcagtacttccacctggcc
gcgtgggccgtgcccgctgtcaagaccatcaccatcctggccatgggccaggtggacggg
gacctgctcagcggggtgtgctacgtgggcctgtccagcgtggacgcgctgcggggcttc
gtgctggcgcccctgttcgtctacctcttcatcggcacgtccttcttgctggccggcttc
gtgtcgctgttccgcatccgcaccatcatgaagcatgacggcaccaaaaccgagaagctg
gagaagctcatggtgcgcatcggcgttttcagcgtgctctacaccgtgccggccaccatc
gttctggcctgctacttctacgagcaggccttccgcgaacactgggagcgcacctggctc
ctgcagacgtgcaagagctacgcggtgccctgcccgcccggccacttcccgcccatgagc
cccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtaggcatcaccact
ggcttctggatctggtccggcaagacgctgcagtcgtggcgccgcttctaccacagactc
agccacagcagcaagggggagactgcggtatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010053
Entry
103010053         CDS       T03086                                 

Gene name
FZD3
Definition
(RefSeq) frizzled class receptor 3
  KO
K02329  frizzled 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103010053 (FZD3)
   04390 Hippo signaling pathway
    103010053 (FZD3)
   04150 mTOR signaling pathway
    103010053 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103010053 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103010053 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    103010053 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010053 (FZD3)
   05206 MicroRNAs in cancer
    103010053 (FZD3)
   05205 Proteoglycans in cancer
    103010053 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103010053 (FZD3)
   05226 Gastric cancer
    103010053 (FZD3)
   05217 Basal cell carcinoma
    103010053 (FZD3)
   05224 Breast cancer
    103010053 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103010053 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    103010053 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103010053 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103010053 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bacu04030]
    103010053 (FZD3)
G protein-coupled receptors [BR:bacu04030]
 Frizzled / Smoothened family
  103010053 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 103010053
NCBI-ProteinID: XP_007192779
UniProt: A0A384B0G0
LinkDB
Position
Un
AA seq 666 aa
MAMSWIVFILWPLTMFVGHIGGHSLFSCEPITLRMCQDLPYNATFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQMDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDSLRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLIVF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSVRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggattgtcttcattctgtggcccttgactatgtttgtggggcatata
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatgctaccttcatgcctaatcttctgaatcattatgaccaacagacagcagctttg
gcaatggagccattccaccctatggtgaatttggattgttctcgggatttccggccattt
ctttgtgcactctacgctcctatttgtatggaatacggacgtgtcacacttccctgccgt
aggctctgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccgtatcctcgactt
gtggatctgaatttagctggagatcctactgaaggagccccagtggcagtgcagatggac
tatggtttttggtgtccccgagagttgaaaattgatcctgatcttggctattcttttttg
cacgtgcgtgattgttcacctccttgtccaaatatgtactttaggagagaagaactttca
tttgctcgatatttcataggattgatttcaatcatttgcctctctgccacattatttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaagacctattatattt
tatgcagtctgctacatgatggtatcgttaattttctttattgggtttttgcttgaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttccacagtgacccaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctggc
agcgtttggtgggtaattcttaccatcacgtggttcttggcagctgtgccgaagtggggt
agtgaagctattgagaagaaggcattgctatttcacgccagcgcgtggggcatccctgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgttgattcattgaggtattttgttcttgcacccctctgc
ctgtatgtggtagttggggtttcacttctcttagccggcatcatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaactggtgaagtttatgatccgg
attggtgttttcagcattctttatcttgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacctgattgtcttt
ctgatgaaatacctgatggctctcatagttggtattccttccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcagtccctcctgagggatcca
aatactcctattataagaaaatcaagaggaacttccactcaaggaacatccacacatgct
tcttcaactcagctggccatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacagatcccgtgatggcaggtacactccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactcacggatcac
tccaggcacagtagttcccatcggctcaatgagcagtcacgacatagcagcgtcagagac
ctcagtaataatcctatgactcacatcacacatggtaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015505
Entry
103015505         CDS       T03086                                 

Gene name
FZD9
Definition
(RefSeq) frizzled class receptor 9
  KO
K02842  frizzled 9/10
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103015505 (FZD9)
   04390 Hippo signaling pathway
    103015505 (FZD9)
   04150 mTOR signaling pathway
    103015505 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103015505 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103015505 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015505 (FZD9)
   05205 Proteoglycans in cancer
    103015505 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103015505 (FZD9)
   05226 Gastric cancer
    103015505 (FZD9)
   05217 Basal cell carcinoma
    103015505 (FZD9)
   05224 Breast cancer
    103015505 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103015505 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    103015505 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103015505 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103015505 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bacu04030]
    103015505 (FZD9)
   04090 CD molecules [BR:bacu04090]
    103015505 (FZD9)
G protein-coupled receptors [BR:bacu04030]
 Frizzled / Smoothened family
  103015505 (FZD9)
CD molecules [BR:bacu04090]
 Proteins
  103015505 (FZD9)
SSDB
Motif
Pfam: Frizzled Dicty_CAR DHHC
Other DBs
NCBI-GeneID: 103015505
NCBI-ProteinID: XP_007187076
UniProt: A0A384AI94
LinkDB
Position
Un
AA seq 408 aa
PGDAALGAAGGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCF
FSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYV
IQEGLENTGCSLLFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAW
GLPALKTIVILTLRKVAGDELTGLCYVASMDAGALTGFVLVPLSCYLVLGTSFLLTGFVA
LFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQ
PCSAATTPGGWRDCSLQGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCHR
KMAGGRARAKTCRAPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1227 nt   +upstreamnt  +downstreamnt
cccggcgacgccgccctaggcgccgccggcggcacctgcgagaaccccgagaagttccag
tacgtggagaagagccgctcgtgcgcgccgcgctgcgggccaggcgtcgaggtgttctgg
tcgcggcgcgacaaggacttcgcgctcgtctggatggccgtgtggtcggcgctgtgcttc
ttctccaccgccttcaccgtgctcaccttcttgctggaacctcaccgcttccagtacccg
gagcgccccatcatcttcctttccatgtgctacaacgtctactcgctagccttcctcatc
cgggctgtggctggggcccagagcgtggcttgcgaccaggaggcgggtgcgctctacgtg
atccaggagggcctggagaacacgggctgcagcctcctcttcctgctgctctactacttc
ggcatggccagctcgctgtggtgggtggtgctgaccctcacctggttcctggcggctggc
aagaagtggggccacgaggccatcgaggcccacggcagctacttccacatggcggcctgg
gggctgccggctctcaagaccatcgttatcctgactctgcgcaaggtggcaggggatgag
ctgactgggctctgttacgtggccagcatggatgccggggcgctcacgggcttcgtgctg
gtacccctctcctgctacctggtgctgggcacgagcttcctcctgaccggctttgtggcc
ctcttccacatccgcaagatcatgaagacagggggcaccaacacagagaagctggagaag
ctcatggtcaagattggagtcttctccatcctctacactgtgcccgccacctgcgtcatt
gtgtgctacgtctatgaacgcctcaacatggacttctggcgcttgcgggccacagagcag
ccctgctcggcagccaccacgcccggcggctggagggactgctcgctgcaagggggctca
gtgcccaccgtggctgtctttatgctcaaaatcttcatgtcgctggtggtgggcatcacc
agcggcgtctgggtatggagctccaagactttccagacctggcagagcctgtgccaccgc
aagatggcaggtggccgggcgcgggcaaagacctgccgggcccccgggggctatggccgt
ggcacccactgccactataaggcccctaccgtggtcttgcacatgactaagacggatcct
tctctggagaaccccacacacctctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019298
Entry
103019298         CDS       T03086                                 

Gene name
FZD1
Definition
(RefSeq) frizzled class receptor 1
  KO
K02432  frizzled 1/7
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103019298 (FZD1)
   04390 Hippo signaling pathway
    103019298 (FZD1)
   04150 mTOR signaling pathway
    103019298 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103019298 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103019298 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019298 (FZD1)
   05205 Proteoglycans in cancer
    103019298 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103019298 (FZD1)
   05226 Gastric cancer
    103019298 (FZD1)
   05217 Basal cell carcinoma
    103019298 (FZD1)
   05224 Breast cancer
    103019298 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103019298 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    103019298 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103019298 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103019298 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bacu04030]
    103019298 (FZD1)
G protein-coupled receptors [BR:bacu04030]
 Frizzled / Smoothened family
  103019298 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 103019298
NCBI-ProteinID: XP_007195958
UniProt: A0A384B8V0
LinkDB
Position
Un
AA seq 565 aa
GPGPGQQPPPPQQQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTN
QEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALM
NKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGFRGGG
FAGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRT
WIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVC
NDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIE
ANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFI
GTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAF
RDQWERSWVAQSCKSYAIPCPHLQAGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIW
SGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
gggcccgggccggggcagcagcccccgccgcctcagcagcagcagagcgggcagcagtac
aacggcgagcggggcatctctataccggaccacggctactgccagcccatctccatcccg
ctgtgcacggacatcgcatacaaccagaccatcatgcccaacctgctgggccacacgaac
caggaggatgcgggcctcgaggtgcaccagttctacccgctagtgaaggtgcagtgctcc
gcggagctcaagttcttcctgtgctccatgtacgcgcccgtgtgcaccgtgctggagcag
gctctgccgccttgccgctccctgtgcgagcgcgcgcgccagggctgcgaggcgctcatg
aacaagttcggcttccagtggcctgacacgctcaagtgcgagaagttcccggtgcacggc
gctggcgagctgtgcgtgggccagaacacgtcggacaagggcaccccgacgccctcgctg
ctgcctgagttctggaccagcaacccacagcacggcggcggaggcttccgggggggaggc
ttcgcggggggcgccggcgcgtcggaacgaggcaagttctcgtgcccgcgcgccctcaag
gtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgcgccctgcgag
ccgaccaaggtgtacgggcttatgtattttgggccggaggagctgcgcttctcgcgcacc
tggatcggcatctggtcagtgctgtgctgcgcctccacgctcttcacggtgctcacgtac
ctggtggacatgcggcgcttcagctacccggagcggcccatcatcttcctgtcgggctgc
tacacggcagtggccgtggcctacatcgccggcttcctgctggaggaccgggtggtgtgt
aacgacaaattcgcggaggatggggcacgcacggtggcgcagggcaccaagaaggagggc
tgcaccatcctcttcatgatgctctacttcttcagcatggccagctccatctggtgggtg
atcctgtcgctcacctggttcctggcggccggcatgaagtggggccacgaggccatcgag
gccaactcgcagtactttcacctggccgcctgggccgtgccggccatcaagaccatcacc
atcctggcgctgggccaggtggacggcgatgtgctgagcggggtgtgcttcgtggggctc
aacaacgtggacgcactgcgcggcttcgtgctggcgccactcttcgtgtacctgttcatc
ggcacgtccttcctactggccggcttcgtgtccctcttccgcattcgcactatcatgaag
cacgacggcaccaagaccgagaagctggagaagctcatggtgcgcatcggcgtcttcagc
gtgctctacacggtgccagccactatcgtcattgcctgctacttctacgagcaggccttc
cgggaccagtgggagcgcagctgggtggcccagagctgcaagagctatgctatcccctgc
ccccacctccaggcgggcggcgccccgccgcacccgcccatgagccctgacttcacagtc
ttcatgatcaagtatcttatgacgctgatcgtgggcatcacgtcaggcttctggatctgg
tccggcaagaccctcaactcctggaggaagttctacactaggctcaccaatagcaaacag
ggggagaccaccgtctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020165
Entry
103020165         CDS       T03086                                 

Gene name
FZD4
Definition
(RefSeq) frizzled class receptor 4
  KO
K02354  frizzled 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103020165 (FZD4)
   04390 Hippo signaling pathway
    103020165 (FZD4)
   04150 mTOR signaling pathway
    103020165 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103020165 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103020165 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020165 (FZD4)
   05205 Proteoglycans in cancer
    103020165 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103020165 (FZD4)
   05226 Gastric cancer
    103020165 (FZD4)
   05217 Basal cell carcinoma
    103020165 (FZD4)
   05224 Breast cancer
    103020165 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103020165 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    103020165 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103020165 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103020165 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bacu04030]
    103020165 (FZD4)
   04090 CD molecules [BR:bacu04090]
    103020165 (FZD4)
G protein-coupled receptors [BR:bacu04030]
 Frizzled / Smoothened family
  103020165 (FZD4)
CD molecules [BR:bacu04090]
 Proteins
  103020165 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 103020165
NCBI-ProteinID: XP_007168545
LinkDB
Position
Un
AA seq 538 aa
MAWRGAGPRVLGAPGGVGLSLRLLLLLLLLLRPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKVNIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSARFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALXFRYSADDSNMAVEML
KIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGRGNETVV
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgcgcgtcctgggggcccccgggggcgtcggtctcagc
ctgcggctgctgctactcttgctgctgctcctgaggccggcgcggggcttcggagacgag
gaggagcggcgctgcgaccccatccgcatctctatgtgccagaacctgggctacaacgtg
accaagatgcccaacctggtggggcacgagctgcagacggacgccgagctgcagctgaca
actttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcc
gtgtatgtgcccatgtgcacagagaaggtcaatatccccatcggcccctgcggcgggatg
tgtctttcggtcaagagacgttgcgagcctgtcctgaaggaatttggatttgcctggccg
gagagcctgaactgcagcaaattcccaccacagaatgaccacaaccacatgtgcatggaa
gggccaggtgatgaggaggtgcccttacctcacaaaacccccatccagcctggggaagag
tgccattccgtgggaaccaactctgatcagtacatctgggtgaagaggagcctgaactgc
gttctcaagtgcggctatgatgctggcttatacagccgctcggccaaggagttcaccgat
atctggatggccgtgtgggccagcttgtgcttcatctccaccgccttcactgtgctgacc
ttcctgatcgattctgccaggttttcctacccggagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggata
tcctgcgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacaca
ggatgtgcaatcattttcttgctgatgtacttttttggaatggccagttccatctggtgg
gttattctgacactcacttggtttttggcagcgggactcaaatggggtcatgaagccatt
gaaatgcacagctcttatttccacattgcagcctgggctatccctgcagtgaaaaccatt
gtcatcttgattatgagactggtggatgcagacgaattgactggcctgtgctatgtgggg
aaccaaaaccttgatgccctcacgggctttgtggtggctcccctcttcacttacttggtg
attggaaccttgttcattgctgcaggcttggtggccttgttcaaaattcggtcgaatctt
caaaaggatgggacaaagacagacaagttggaaaggctgatggtcaagattggggtcttc
tcagtcctgtacacggtgcctgcaacctgtgtgattgcctgttatttctatgaaatctcc
aactgggcgctcnncttccggtattccgcagatgactccaatatggcggttgagatgttg
aaaatttttatgtctttgctggtaggcatcacttcaggcatgtggatttggtctgccaaa
actcttcacacgtggcagaagtgttccaacagattggtgaattctgggaaggtaaagaga
gaaaaaagagggaatggttgggtgaagcctgggagaggcaatgaaactgtggtataa

DBGET integrated database retrieval system