KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998386
Entry
102998386         CDS       T03086                                 

Gene name
TLR2
Definition
(RefSeq) toll like receptor 2
  KO
K10159  toll-like receptor 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04145  Phagosome
bacu04151  PI3K-Akt signaling pathway
bacu04620  Toll-like receptor signaling pathway
bacu05132  Salmonella infection
bacu05134  Legionellosis
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05144  Malaria
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05162  Measles
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05205  Proteoglycans in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
bacu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102998386 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102998386 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102998386 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102998386 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102998386 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102998386 (TLR2)
   05321 Inflammatory bowel disease
    102998386 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102998386 (TLR2)
   05134 Legionellosis
    102998386 (TLR2)
   05152 Tuberculosis
    102998386 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102998386 (TLR2)
   05161 Hepatitis B
    102998386 (TLR2)
   05171 Coronavirus disease - COVID-19
    102998386 (TLR2)
   05162 Measles
    102998386 (TLR2)
   05168 Herpes simplex virus 1 infection
    102998386 (TLR2)
   05169 Epstein-Barr virus infection
    102998386 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102998386 (TLR2)
   05144 Malaria
    102998386 (TLR2)
   05145 Toxoplasmosis
    102998386 (TLR2)
   05140 Leishmaniasis
    102998386 (TLR2)
   05142 Chagas disease
    102998386 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    102998386 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    102998386 (TLR2)
   04054 Pattern recognition receptors [BR:bacu04054]
    102998386 (TLR2)
   04090 CD molecules [BR:bacu04090]
    102998386 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    102998386 (TLR2)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    102998386 (TLR2)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102998386 (TLR2)
Pattern recognition receptors [BR:bacu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   102998386 (TLR2)
CD molecules [BR:bacu04090]
 Proteins
  102998386 (TLR2)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Hyaluronan
  Cell surface receptors
   102998386 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_1 LRRCT LRR_9
Other DBs
NCBI-GeneID: 102998386
NCBI-ProteinID: XP_007189504
UniProt: A0A384AQS6
LinkDB
Position
Un
AA seq 785 aa
MPPALWIVWVLGSVISLPKEGASDQASSLSCDPTGVCDGRSRSFNSIPSGLTAAVKSLDL
SSNEITYVSNSDLRRCVDLRTLRLGANEIHTVEEDSFFSLRSLEYLDLSYNRLSNFSSSW
FRSLSALKFLNLLGNLYKTLGERSLFSHLPNLRILKVGNSNSFTEIQEKDFAGLTLLEKL
EINAPNLQTYAPKSLKSIQNISHLILHLKQPILLLEIFVDILSSLECLELRDTNLNTFHF
SEVSINETNTSIKKFAFRNVQITDESFIEVVKLFNYVSGVLEVEFDDCTHDGVGDFRTLT
LDTIKYLGDVETLTIRKLHIPQFFLYHDLSNIYSLTGKVKRITIENSKVFLVPCLLSQHL
KSLEYLDLSENLMSEETLKNSACEHAWPFLKTLVLRQNRLESLEKTGEILLTLQNLTNLD
ISKNNFHSMPETCQWPGKMKYLNLSSTRIQSLTRCIPQTLEILDISNNNLDSFSLILPEL
KELYISRNKLKTLPDASFLPVLLVMRISRNIINTFSKEQLDSFQKLKTLEAGGNSFICSC
DFLSFTQGQQDLAQVLIDWPEDYLCDSPSPVRGQRVQDTRLSPSECHRAAVVSAVCCALF
LLLLLMGILCHRFHGLWYMKMMWAWLQAKRKPRKAPRRDICYDAFVSYSERDSYWVENLM
VQELEHFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTIFVLSENFVKSEWCKYELDF
SHFRLFDENDDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPADEMQQEGFWLNLR
AAIKS
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgccacctgcattgtggatagtgtgggtcttggggtctgtaatcagcctccccaaggaa
ggagcctctgatcaggcttcttctctgtcttgtgaccccactggtgtctgcgatggccgc
tccagatctttcaactccatcccctcagggctcacggcagctgtgaaaagccttgacctg
tccagcaatgagatcacctatgtcagcaacagtgacctgcggaggtgtgtggacctcagg
actctgaggctgggggccaatgaaattcacacagtggaggaagattcttttttttccctg
aggagtcttgaatatttggacttatcctataatcgtttatctaacttctcatcctcctgg
ttcagatccctttctgccttgaaattcttaaacttactgggaaatttatacaaaacactt
ggggaaagatctcttttttctcatcttccaaatctgcgaatcctgaaagtaggaaatagt
aacagcttcactgagattcaggaaaaggatttcgctgggctaactcttcttgagaaactt
gagattaatgctccaaatctgcagacgtatgcgccaaagagtttaaagtcaatccagaac
atcagccatctgattcttcatctgaagcagcctattttactgctggagatttttgtagat
attttaagttccttagaatgtttagaactgagagatactaatttgaacacttttcatttt
tcagaagtatccatcaatgaaacgaatacatcaattaaaaagtttgcgtttagaaatgtg
caaatcactgacgaaagttttattgaagttgtgaaactgtttaattatgtttctggagtc
ttagaagtagagtttgatgactgtacccatgatggagttggtgattttaggacattgact
ctggacacaattaaatacctaggtgacgtggagacattaacaatacggaagttgcatatt
ccacagtttttcttatatcatgatctgagtaatatatattcactcacaggaaaagttaaa
agaatcacaatagaaaacagtaaggtttttctggttccttgtttactttcacaacattta
aaatcattagaatatttggatctcagtgaaaacttaatgtctgaagaaaccttgaaaaac
tcagcctgtgagcatgcttggcccttcctaaaaaccttagttttaaggcagaatcgtttg
gaatcattagaaaaaactggagaaattttgcttactctgcaaaacctgactaaccttgat
atcagtaagaataattttcattcaatgcctgaaacttgtcagtggccaggaaaaatgaaa
tatttgaacttatccagcacaagaatacaaagtttaacccgttgcattccccagacactg
gaaattttagatattagcaataacaatctcgattcattttctttgattttgccagaactc
aaagaactttatatttccagaaataagttgaagactctaccagatgcctccttcttacct
gtgttattagttatgagaatcagcagaaatataataaatactttctctaaggagcaactt
gattcttttcaaaaactgaagactttggaagctggtggcaacagcttcatttgctcctgt
gacttcctgtctttcacgcaggggcagcaggacctggcccaggtcctgatcgactggcca
gaagactacctgtgtgactctccatcccccgtgcggggccagcgcgttcaggacacccgg
ctctcaccttctgaatgccacagggcagccgtggtgtctgctgtgtgctgtgcccttttc
ctgttgctcctgctcatggggattctgtgccaccgtttccacggactgtggtacatgaag
atgatgtgggcctggctccaggccaagaggaagcccaggaaggctccccgcagggacatc
tgctatgatgcctttgtgtcctacagtgaacgggattcctactgggtggagaacctcatg
gtccaggagctggagcacttcaaccctccctttaagttgtgtcttcacaagcgggacttc
attcctggcaagtggattattgacaatatcattgactccattgaaaagagccacaaaacc
atcttcgtgctttctgagaactttgtgaagagtgagtggtgcaagtacgagctggacttc
tcccattttcgtctctttgatgagaacgacgatgctgccattctcattctgctggagccc
attgagaaaaaggccatcccccagcgtttctgtaagctgcggaagattatgaacaccaag
acctacttggagtggcccgctgatgagatgcagcaggaagggttttggttaaatttgaga
gctgcgataaagtcctag

DBGET integrated database retrieval system