KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998477Help
Entry
102998477         CDS       T03086                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04110  Cell cycle
bacu04213  Longevity regulating pathway - multiple species
bacu04330  Notch signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05016  Huntington's disease
bacu05034  Alcoholism
bacu05165  Human papillomavirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102998477 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102998477 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102998477 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    102998477 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102998477 (HDAC1)
   05202 Transcriptional misregulation in cancers
    102998477 (HDAC1)
   05203 Viral carcinogenesis
    102998477 (HDAC1)
   05220 Chronic myeloid leukemia
    102998477 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    102998477 (HDAC1)
  Substance dependence
   05034 Alcoholism
    102998477 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    102998477 (HDAC1)
   05165 Human papillomavirus infection
    102998477 (HDAC1)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102998477 (HDAC1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102998477 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102998477 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102998477 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102998477 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102998477
NCBI-ProteinID: XP_007170674
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAVPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEATEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaggaggaaagtctgttactactatgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctccttaactatggtctctaccgaaagatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtatcacagtgatgactacatcaaattcttgcgctccatccgc
ccagataacatgtctgagtacagcaagcagatgcagagatttaacgttggtgaggactgt
ccggtatttgatggcctctttgagttctgtcagctatctactggtggctctgtggcaagt
gccgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctacac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgagtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tattatgctgttaactacccgctccgagatgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcccagtgcagtcgtcttacag
tgtggctctgactccttgtctggcgatcggttaggttgcttcaatttgaccatcaaaggg
cacgccaagtgtgtggaatttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggtggctacaccattcgtaatgtcgcccggtgctggacatacgaaacagctgtggccctg
gacacggagatccctaatgagcttccatacaacgactacttcgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgactaaccagaacactaatgagtacctggaa
aagatcaaacagcgactgtttgagaacctgagaatgctgccccacgcacctggggtccaa
atgcaggccattcctgaggatgccgttccagaggagagtggcgatgaggatgaagaagac
cctgacaagcgcatttcaatctgttcctcggacaaacgaattgcctgtgaggaagagttc
tccgactctgacgaggagggagaaggcggtcgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaagatgagaaagagaaagacccagaagagaagaaagaagccaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system