KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998750
Entry
102998750         CDS       T03086                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04350  TGF-beta signaling pathway
bacu04371  Apelin signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04714  Thermogenesis
bacu04910  Insulin signaling pathway
bacu04931  Insulin resistance
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05221  Acute myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102998750 (RPS6KB2)
   04350 TGF-beta signaling pathway
    102998750 (RPS6KB2)
   04371 Apelin signaling pathway
    102998750 (RPS6KB2)
   04066 HIF-1 signaling pathway
    102998750 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    102998750 (RPS6KB2)
   04152 AMPK signaling pathway
    102998750 (RPS6KB2)
   04150 mTOR signaling pathway
    102998750 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102998750 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102998750 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102998750 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    102998750 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    102998750 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102998750 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102998750 (RPS6KB2)
   05205 Proteoglycans in cancer
    102998750 (RPS6KB2)
   05231 Choline metabolism in cancer
    102998750 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102998750 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102998750 (RPS6KB2)
   05212 Pancreatic cancer
    102998750 (RPS6KB2)
   05225 Hepatocellular carcinoma
    102998750 (RPS6KB2)
   05226 Gastric cancer
    102998750 (RPS6KB2)
   05221 Acute myeloid leukemia
    102998750 (RPS6KB2)
   05224 Breast cancer
    102998750 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102998750 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102998750 (RPS6KB2)
   05163 Human cytomegalovirus infection
    102998750 (RPS6KB2)
   05165 Human papillomavirus infection
    102998750 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102998750 (RPS6KB2)
   01522 Endocrine resistance
    102998750 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    102998750 (RPS6KB2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102998750 (RPS6KB2)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102998750 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 102998750
NCBI-ProteinID: XP_007171124
UniProt: A0A383Z8C1
LinkDB
Position
Un
AA seq 590 aa
MHLDSAPSKVKVALEPKWSACRRPLSCAAPGEAVLGRLRGPRKKVRRALAPLHSGTTIPE
MPCDGRQLFSPPARGRGSLLRHRCARPPSRSDDVRPGPACQSERGWVSAWGPAGPAQPWR
RCLTWTWRRRKAARARASQSSAPRPVGRYEEVELTESSVNPGPERIGPHCFELLRVLGKG
NYGKVFQVRKVQGTNVGRIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAY
AFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLSEITLALGHLHSQGIIYRDLK
PENIMLNSQGHIKLTDFGLCKESIHEGAVTPTFCGTIEYMAPEILVRSGHNRAVDWWSLG
ALMYDMLTGSPPFTAENRKKTMDKIIRGKLELPAYLTPDARDLVKKFLKRNPSQRIGGGP
GDAADVQRHPFFRHVNWDDLLARRVDPPFRPSLQSEEDVSQFDSHFTRQTPVDSPDDTAL
SESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPWTPISPLKFSPFEGFRPS
PGPPEPPEPPLPPLLLPLLPPPPPSSTAPLPIRPPSGTKKSKKGRGRPGR
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgcacttggactctgccccgtccaaagtcaaagtcgccctagaaccaaaatggtcggct
tgcaggaggcccttgtcctgtgccgccccgggggaagctgtgctgggaagactgaggggc
ccgcggaagaaggttcggcgggctttagcacccctgcactcaggaactaccattcccgag
atgccttgtgacggacgccaacttttctcgcctccggctcgcgggaggggcagcctcttg
cgtcatcggtgcgcgaggccgccgtcgcggagtgatgacgtaaggcccgggccggcctgt
cagtcagagcgcggctgggtaagcgcctgggggcccgcggggccggcgcagccatggcgg
cggtgtttgacctggacctggagacggaggaaggcagcgagggcgagggcgagccagagt
tcagccccgcggcctgtgggacgctatgaggaggtggagctgactgagagcagtgtgaac
ccgggccctgagcgcatcgggccccactgctttgagctgctgcgtgtgctgggcaagggg
aactatggcaaggtgttccaggtgcgaaaggtgcagggcaccaatgtgggcagaatatat
gccatgaaagtcctgaggaaggccaaaattgtgcgcaacgccaaggacacggcgcacacg
cgggctgagcggaacattctagagtcagtgaagcaccccttcattgtggaactggcctat
gccttccagactggcggcaaactctacctcatcctggagtgcctcagtggcggcgagctc
ttcacacatctggagcgagagggcatcttcctggaagacacggcctgtttctacctgtca
gagatcacactggccctgggccatctccactcccaaggcatcatctaccgggatctcaaa
cctgagaacatcatgctcaacagccagggtcacatcaaactgacggacttcggcctctgc
aaggagtcgattcacgagggtgccgtcacccccaccttctgcggcaccattgagtacatg
gcccctgagattctggtgcgcagtggccacaatcgggcggtggactggtggagcttgggg
gccctgatgtacgacatgctcactggatcgccacccttcactgcagagaaccggaagaaa
accatggacaagatcatcagagggaagctggagctgcctgcctacctcaccccggatgcc
cgggacctcgtcaagaagtttctgaagcggaatcccagccaacgtatcgggggtggcccc
ggggacgccgctgatgtgcagaggcaccccttcttccggcacgttaattgggacgacctc
ctggcccgccgcgtggacccccctttccggccctccctgcagtcggaggaggacgtgagc
cagtttgactcccacttcacgaggcagacgccggtggacagtccagacgacacggccctc
agtgagagcgccaaccaggccttcctgggcttcacgtacgtggcgccctccgtcctggac
agcatcaaggagggcttctccttccagcccaagctgcgctcccccaggcgcctcaacagc
agcccctggacccccatcagccccctgaagttctcgccctttgagggattccggcccagc
cccggcccaccagagcccccggagccccctctaccccctctcctgctcccgctgctgcca
ccaccaccaccctcgagcactgcccccctccccatccgacccccctcagggaccaagaag
tccaagaaaggccgtgggcgccccgggcgctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019799
Entry
103019799         CDS       T03086                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04350  TGF-beta signaling pathway
bacu04371  Apelin signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04714  Thermogenesis
bacu04910  Insulin signaling pathway
bacu04931  Insulin resistance
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05221  Acute myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103019799 (RPS6KB1)
   04350 TGF-beta signaling pathway
    103019799 (RPS6KB1)
   04371 Apelin signaling pathway
    103019799 (RPS6KB1)
   04066 HIF-1 signaling pathway
    103019799 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    103019799 (RPS6KB1)
   04152 AMPK signaling pathway
    103019799 (RPS6KB1)
   04150 mTOR signaling pathway
    103019799 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103019799 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103019799 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103019799 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    103019799 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    103019799 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103019799 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019799 (RPS6KB1)
   05205 Proteoglycans in cancer
    103019799 (RPS6KB1)
   05231 Choline metabolism in cancer
    103019799 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103019799 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103019799 (RPS6KB1)
   05212 Pancreatic cancer
    103019799 (RPS6KB1)
   05225 Hepatocellular carcinoma
    103019799 (RPS6KB1)
   05226 Gastric cancer
    103019799 (RPS6KB1)
   05221 Acute myeloid leukemia
    103019799 (RPS6KB1)
   05224 Breast cancer
    103019799 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103019799 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103019799 (RPS6KB1)
   05163 Human cytomegalovirus infection
    103019799 (RPS6KB1)
   05165 Human papillomavirus infection
    103019799 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103019799 (RPS6KB1)
   01522 Endocrine resistance
    103019799 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103019799 (RPS6KB1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103019799 (RPS6KB1)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   103019799 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103019799
NCBI-ProteinID: XP_007190341
UniProt: A0A384ASG2
LinkDB
Position
Un
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQAPVEYPMETSG
IEQMDVTVSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggtttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggagcattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgagtacttggtaaaggg
ggctatggaaaggtttttcaagtgcgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagattttggactatgc
aaagaatctattcatgacggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtctggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggacgctggagaagttcaagctcatccattcttcagacatattaactgggaagaactg
ctggctcggaaggtagagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacgtatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccggtcacctcgaagatttattggc
agcccacggacacctgtcagccctgtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcaggcgcctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgacggtgagtggggaagcttcagcaccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagaacac
ctgcgtatgaatctatga

DBGET integrated database retrieval system