KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998771
Entry
102998771         CDS       T03086                                 

Gene name
TLR3
Definition
(RefSeq) toll like receptor 3
  KO
K05401  toll-like receptor 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04217  Necroptosis
bacu04620  Toll-like receptor signaling pathway
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102998771 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102998771 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    102998771 (TLR3)
   05160 Hepatitis C
    102998771 (TLR3)
   05171 Coronavirus disease - COVID-19
    102998771 (TLR3)
   05164 Influenza A
    102998771 (TLR3)
   05168 Herpes simplex virus 1 infection
    102998771 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102998771 (TLR3)
   05165 Human papillomavirus infection
    102998771 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:bacu04054]
    102998771 (TLR3)
   04090 CD molecules [BR:bacu04090]
    102998771 (TLR3)
Pattern recognition receptors [BR:bacu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   102998771 (TLR3)
CD molecules [BR:bacu04090]
 Proteins
  102998771 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR LRR_1 TIR_2 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 102998771
NCBI-ProteinID: XP_007174037
UniProt: A0A383ZFV5
LinkDB
Position
Un
AA seq 957 aa
MKTTGFGLMKKGAVSCRQSFRIFLVDDHNSDVSEESVSFSFFTHPGLAFGKIMRRYLLYR
IYSFLGLLPFWILCTSSTNKCTVRHEIADCSHLKLTQIPDDLPTNITVLNLTHNQLRRLP
PDNFTRYSQLTILDGGFNSISKLEPELCQRLPLLEILNLQHNELSQLSDKTFIFCMNLTE
LHLMSNSIQKIQNNPFKNLKNLIKLNLAHNGLSSTKLGTQLQLENLQELLLSNNKISALR
REELDFLGNSSLKRLELSSNQIMEFSPGCFHAVGKLFGFSLNNAKLSPSLIEELCLELSN
TSIQNLSLSNNQLYTTSNKTFVGLKQTNLTVLDLSHNSLSVIGNDSFAWLPHLEYLFLEY
NNIEHLSSRSFYGLSNVRYLNLRRSFTKQSVSLASLPKIDDFSFQWLKFLEYLNMEDNNF
PGIKSNTFTGLTKLRCLSLSNSFSSLRTLTNETFLSLAGSPLLILNLTKNKISKIESGAF
SWLGHLTVLDLGLNEIGQELTGQEWRGLENIVEIYLSYNKYLELTSNSFALVPSLQRLML
RRVALKNVDSSPSPFHPLPNLTILDLSNNNIANINDELLKGLEKLEILDLQHNNLARLWK
HANPGGPVHFLKGLSHLYILNLESNGFDEIPAEVFKDLRELKSIDLGLNNLNILPPSVFD
NQVLLKSLSLQKNLITSVEKNVFGPAFKNLSNLDMRFNPFDCTCESIAWFVNWINNTHTN
ISELSSRYLCNTPPQYRGFPVMLFDISPCKDSAPFELLFMINTSILLIFIFIVLLIHFEG
WKISFYWNVTVHRVLGFKEIDRQPEQFEYAAYIIHAYKDRDWVWEHFSPMEEEDHTLRFC
LEERDFEAGVLELEAIVNSIRRSRKIIFVITQNLLKDPLCKRFKVHHAVQQAIEQNLDSI
ILIFLEDIPDYKLNHALCLRRGMFRSRCILNWPIQKERVNAFHHKLQVALGSRNSVH
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgaaaacgactggatttggactaatgaaaaaaggagcggtcagctgccgtcagagtttt
aggatttttttggtggatgatcacaattctgacgtttcagaagagtctgtgtctttttcc
tttttcactcatcctggcctggcatttggcaaaatcatgagaaggtatttgctttatcgt
atctactcctttttgggactgttgcccttttggatactgtgcacatcttctaccaacaaa
tgtactgttagacatgaaatagctgactgcagtcatctgaagttgactcaaatacctgat
gacctcccaacaaacataacagtgttgaatcttacccataatcaactcagaagattacca
cctgacaattttacaagatatagccaacttactatcttggatggaggatttaactccatc
tcaaagctggagccagaattgtgccaacgtctccctttgttggaaattttgaacctccaa
cacaatgagctatctcagctttctgataaaacctttatcttctgcatgaatttgactgaa
ctccatctaatgtccaactcaatccagaaaattcaaaataatccctttaaaaacctgaag
aatttaatcaaattaaacctagctcataatggtttatcatctactaaattaggaactcag
ctgcaactggaaaatctccaagagcttctactatcaaataataaaatttctgcactaaga
cgtgaagaacttgatttccttggcaactcttctttaaaaagattagagttgtcatcaaat
caaataatggagttctctccagggtgttttcatgcagttggaaaattatttggcttctct
ctgaacaatgccaaactgagccccagtctcatagaagagctctgcttggaattatcaaac
acaagcattcagaatctgtccctgagcaacaaccagctgtacacaaccagcaacaagact
tttgttgggctgaagcagacaaatctcacagtgctcgatctttcccataacagcttaagt
gtgattggtaatgattcctttgcttggcttccacatctagaatatctctttctggagtat
aacaatatagaacatctgtcttctcgctctttttatgggctttccaatgtgagatacctg
aatttgagacgatcttttactaaacaaagcgtttccctggcttcacttcccaagattgat
gatttttcctttcagtggctaaaatttttggagtatctcaatatggaagataacaacttt
ccaggcataaaaagcaatactttcacgggattgacaaagctgagatgtttaagtctatcc
aactccttctcaagtttgcgaactttaacaaatgaaacatttttatcacttgctggttct
cctctgctcatactcaacctaaccaaaaataaaatctcaaaaatagagagtggtgctttt
tcttggttgggccacctaactgtacttgaccttggtcttaatgaaattgggcaagaactc
acaggccaggaatggagaggtctagaaaatattgttgaaatctacctttcctacaacaaa
tacctagagctgactagcaactcttttgccttggttccaagccttcaacgactgatgctc
cgaagggtggcccttaaaaatgtggatagctccccttcaccttttcaccctcttcctaac
ctgaccattctggatctaagcaacaacaacatagccaacataaatgatgaactgttgaag
ggtcttgagaaactagaaattctggatttgcagcataacaacttagctcgcctctggaag
catgcaaaccctggcggtcctgttcattttctgaagggtctttctcacctctacatcctt
aacttagagtctaatggctttgatgagatcccagcagaagtcttcaaggacttacgtgaa
ttgaagagcatcgatttaggattgaataatttaaatatccttccaccatctgtctttgat
aatcaagtgttgctaaagtcattaagccttcagaagaatctcataacatctgttgaaaag
aacgtttttgggccagcattcaagaacctgagtaatttagatatgcgctttaatccattt
gattgtacatgtgaaagcattgcctggtttgttaattggattaataatacccatacgaac
atctctgaactatcaagccgttacctctgcaacactccacctcaatatcgtggtttccca
gtgatgctttttgatatatcaccctgcaaagacagtgccccatttgaactccttttcatg
ataaataccagtatcctattgattttcatctttattgtacttctcatccattttgaaggc
tggaagatatctttttattggaatgttacagtgcatcgagttcttggtttcaaagaaata
gacagacagccagaacagtttgaatatgcggcatatataattcatgcctataaagatagg
gattgggtctgggaacacttctccccgatggaagaagaagatcatacactcagattctgt
ctggaagaaagggattttgaggcaggtgtccttgaacttgaagcaattgttaatagcatc
agaaggagcagaaaaattatttttgttataacacagaatctactgaaagatccattatgc
aaaagattcaaggtgcaccacgcagttcagcaagctattgaacaaaatctggattccatt
atattgatctttcttgaggatattccggattataaactgaatcatgcgctctgtttgcga
agagggatgtttagatctcgctgcatcttgaactggccgattcagaaagaacgggtaaat
gcctttcatcataaattgcaagtagcacttggttccagaaattcagtacattaa

DBGET integrated database retrieval system