KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102998893
Entry
102998893         CDS       T03086                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04012  ErbB signaling pathway
bacu04062  Chemokine signaling pathway
bacu04110  Cell cycle
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04310  Wnt signaling pathway
bacu04340  Hedgehog signaling pathway
bacu04360  Axon guidance
bacu04390  Hippo signaling pathway
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04657  IL-17 signaling pathway
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04728  Dopaminergic synapse
bacu04910  Insulin signaling pathway
bacu04916  Melanogenesis
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05135  Yersinia infection
bacu05160  Hepatitis C
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102998893 (GSK3B)
   04310 Wnt signaling pathway
    102998893 (GSK3B)
   04340 Hedgehog signaling pathway
    102998893 (GSK3B)
   04390 Hippo signaling pathway
    102998893 (GSK3B)
   04151 PI3K-Akt signaling pathway
    102998893 (GSK3B)
   04150 mTOR signaling pathway
    102998893 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102998893 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102998893 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    102998893 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102998893 (GSK3B)
   04657 IL-17 signaling pathway
    102998893 (GSK3B)
   04662 B cell receptor signaling pathway
    102998893 (GSK3B)
   04062 Chemokine signaling pathway
    102998893 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102998893 (GSK3B)
   04917 Prolactin signaling pathway
    102998893 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    102998893 (GSK3B)
   04919 Thyroid hormone signaling pathway
    102998893 (GSK3B)
   04916 Melanogenesis
    102998893 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102998893 (GSK3B)
   04722 Neurotrophin signaling pathway
    102998893 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    102998893 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102998893 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102998893 (GSK3B)
   05225 Hepatocellular carcinoma
    102998893 (GSK3B)
   05226 Gastric cancer
    102998893 (GSK3B)
   05217 Basal cell carcinoma
    102998893 (GSK3B)
   05215 Prostate cancer
    102998893 (GSK3B)
   05213 Endometrial cancer
    102998893 (GSK3B)
   05224 Breast cancer
    102998893 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102998893 (GSK3B)
   05020 Prion disease
    102998893 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    102998893 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102998893 (GSK3B)
   04931 Insulin resistance
    102998893 (GSK3B)
   04934 Cushing syndrome
    102998893 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102998893 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102998893 (GSK3B)
   05162 Measles
    102998893 (GSK3B)
   05163 Human cytomegalovirus infection
    102998893 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102998893 (GSK3B)
   05165 Human papillomavirus infection
    102998893 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102998893 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    102998893 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    102998893 (GSK3B)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     102998893 (GSK3B)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   102998893 (GSK3B)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102998893 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 102998893
NCBI-ProteinID: XP_007181928
UniProt: A0A384A3N2
LinkDB
Position
Un
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPSNTTAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcgtttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctggacagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattgggaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gaaaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgttaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttgctaggacaaccaatatttccaggggac
agtggtgtggatcaattggtagaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagttcgggtcttccgacct
cgaactccaccagaggcgattgcactatgtagccgtctgctggagtatacccccactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaaccccttcaaataccacagcagcctcagatgctaatgctggagaccgtggacag
accaataacgccgcttccgcatcagcttccaactccacctga

DBGET integrated database retrieval system