KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999013Help
Entry
102999013         CDS       T03086                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bacu03012]
    102999013 (TUFM)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    102999013 (TUFM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    102999013 (TUFM)
Translation factors [BR:bacu03012]
 Eukaryotic Type
  Elongation factors
   102999013 (TUFM)
 Prokaryotic Type
   102999013 (TUFM)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    102999013 (TUFM)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102999013 (TUFM)
  Exosomal proteins of breast cancer cells
   102999013 (TUFM)
  Exosomal proteins of colorectal cancer cells
   102999013 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 102999013
NCBI-ProteinID: XP_007186412
UniProt: A0A384AGE0
LinkDB All DBs
Position
Un
AA seq 452 aa AA seqDB search
MAASTLLRATPLFSGLGAGPTPLLKGLLRPLKAPALPLLCRGLAVEAKKIYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTTAR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVERVVVYV
NKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGLKSVQKLL
DAVDTYITVPTRDLEKPFLLPIESVYSIPGRGTVVTGTLERGILKRGDECEFLGHNKNIR
SVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVYILS
KEEGGRHKPFVSHFMPVMFSLTWDMACRTVLPPGKELAMPGEDLKLTLILRQPMILEKGQ
RFTLRDGNRTIGTGLVTDTPAMTEEDKNIKWS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcgaccctgctgcgcgcgacgcccctcttcagcggtctcggcgccggcccg
accccactgctgaagggtcttttgcggccgctgaaggccccggcattgcccctcttgtgc
cgcggcctggctgtggaggccaagaagatctatgtgcgcgacaagccccatgtaaacgtg
ggtaccattggccatgtagaccacggcaagaccacactgaccgcggccatcacgaaaatt
ttagccgagggaggtggggccaagtttaagaaatacgaggagattgacaatgcccctgaa
gagcgagcccgaggtatcacaatcaatgccgcccatgtggagtacagcaccactgcccgc
cactacgcccacactgactgtcccggtcatgcagactacgttaagaatatgatcacaggc
acagcccccctcgacggctgcatcctggtggtggcagctaacgatggccccatgccccag
acccgagaacacttattactggccaaacagattggagtagagcgtgtggtggtgtatgtg
aacaaggcggatgctgtgcaggactctgagatggtggagctggttgagctggagatcagg
gaactgctcactgaatttggctacaaaggggaggagactccggtcatcgttggctctgcc
ctctgcgcccttgagcaacgtgaccctgagctaggcttgaagtctgtacagaagctgctg
gatgctgtggacacttacatcacagtgcccacccgggacctggagaagcctttcctgctg
cctatagagtcagtgtactctatccccggccggggcacggtggtgacaggcacactagag
cgtggcattttgaagaggggagatgagtgtgaattcctgggacataacaagaatattcgc
agtgtggtgacaggcattgagatgttccacaagagcctggagagggcagaggcaggcgac
aaccttggggccctggtccgcggcttgaagcgggaggacctgaggcgtggcctggtcatg
gccaagccaggttccatccagccccaccagaaggtggaggcacaggtgtacatcctcagt
aaggaggagggtggccgccacaagccctttgtatcccacttcatgcctgtcatgttctcc
ctgacttgggacatggcctgtcggactgtcctgcctccagggaaggagcttgccatgccc
ggggaggacctgaagctcaccctaatcctgcggcagccaatgatcttagaaaaaggccag
cgtttcaccctgcgagatggcaaccggaccatcggcaccggcctcgtcactgacacacca
gccatgaccgaggaagacaagaacatcaagtggagctga

DBGET integrated database retrieval system