KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999027
Entry
102999027         CDS       T03086                                 

Gene name
KIT
Definition
(RefSeq) KIT proto-oncogene receptor tyrosine kinase
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04640  Hematopoietic cell lineage
bacu04916  Melanogenesis
bacu05200  Pathways in cancer
bacu05221  Acute myeloid leukemia
bacu05224  Breast cancer
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999027 (KIT)
   04014 Ras signaling pathway
    102999027 (KIT)
   04015 Rap1 signaling pathway
    102999027 (KIT)
   04072 Phospholipase D signaling pathway
    102999027 (KIT)
   04151 PI3K-Akt signaling pathway
    102999027 (KIT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102999027 (KIT)
  09152 Endocrine system
   04916 Melanogenesis
    102999027 (KIT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999027 (KIT)
   05230 Central carbon metabolism in cancer
    102999027 (KIT)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102999027 (KIT)
   05224 Breast cancer
    102999027 (KIT)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102999027 (KIT)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102999027 (KIT)
CD molecules [BR:bacu04090]
 Proteins
  102999027 (KIT)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 Ig_6 V-set C1-set APH
Other DBs
NCBI-GeneID: 102999027
NCBI-ProteinID: XP_007168486
UniProt: A0A383Z0B1
LinkDB
Position
Un
AA seq 977 aa
MRGARGAWDFLFVLVLLLRVQTGSSQPSVSPGELSPPSIQPAKSELIVSVGDEIRLLCTD
PGFVKWTFETLGQLREKTYPEWITKKAEATNTGNYTCTNEGGLSGSIYVFVRDPEKLFLV
ELPLYGKEGNDTLVRCPLTDPEVTNYSLTGCEGKPLPKDLTFVADPKAGITIKNVKREYH
RLCLHCSANQKGKSVLSKKFTLKVRAAIRAVPVVSVSKASYLLRQGEEFAVMCLIKDVSS
SVDSMWIRENSQQTKEQVKRNSWHQGDFNFLRQERLTISSARVNDSGVFMCYANNTFGSA
NVTTTLEVVDKGFINIFPMMNTTVFVNDGENVDLVVEYEAYPKPEHRQWIYMNRTSTDKW
EDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDANSSVTFNVYVNTKPEILTRD
RLMNGMLQCVAAGFPEPTIDWYFCPGTEQRCSVPVGPVDVQIQNSSVSPFGKLVVYSSID
DSAFKHNGTVECRAYNDVGKSSAYFNFAFKGNSKEQIHAHTLFTPLLIGFVIAAGMMCII
VMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGA
FGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHVNIVNLLGA
CTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCGDSTN
EYMDMKPGVSYVVPTKADKRRSARIGSYIERDMTPAIMEDDELALDLEDLLSFSYQVAKG
MAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPE
SIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEM
YDIMKTCWDADPLKRPTFQQIVQLIEKQISESTNHIYSNLANCSPHRETPAVDRSVRINS
VGSSASSTQPLLVHEDV
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggatttcctcttcgtcttggtgctcctgctccgcgtc
cagacaggctcttctcaaccatctgtgagtccaggggaactgtctccaccatccatccaa
ccagcaaaatcagagttaattgtcagtgtcggcgatgagattaggctgttatgcaccgac
ccaggatttgtcaagtggacttttgagactctgggtcaattgagagagaaaacataccca
gaatggatcaccaagaaagcagaggccacaaatacaggcaattacacgtgcaccaatgaa
ggcggcttgagcggttccatttatgtgtttgttagagatcctgagaagcttttcctggtt
gagcttcccttgtacgggaaggaaggcaacgacacgctggtccgctgtcctctgacagac
ccagaggtgaccaattactccctcacggggtgcgaggggaaacctcttcccaaggacttg
acgtttgtcgctgaccccaaggccggcatcacgatcaaaaacgtgaagcgcgagtatcat
cggctctgtctacactgctcggcaaaccagaagggcaagtccgtgctgtcgaagaaattc
accctgaaagtgagggcagccatcagagctgtgcctgttgtgtctgtgtccaaagccagc
tatcttctcaggcaaggggaagaatttgcagtgatgtgtttgataaaagatgtgtctagc
tctgtggactcaatgtggataagggaaaacagccagcagactaaagaacaggtgaagagg
aatagctggcatcagggtgacttcaattttctccgtcaggaaagattgactatcagctca
gcaagagttaatgattctggcgtgttcatgtgttatgccaataatacttttggatcagca
aatgtcacaacaaccttagaagtagtagataaaggattcattaatatcttccctatgatg
aatacaacagtatttgtaaacgatggcgagaatgtggatctggttgttgagtatgaggca
tatcccaaacctgaacaccgacagtggatatatatgaacagaacttccactgacaagtgg
gaagattaccccaagtctgagaatgaaagtaacatcagatatgtaagtgaacttcatcta
accagattaaaagggaccgaaggaggcacttacacatttctcgtgtccaattctgatgcg
aattcttctgtgacatttaatgtttacgtgaacacaaagccagaaatcctgactcgtgac
aggctcatgaatggcatgctgcagtgtgtagcggcaggattcccagagcccaccatcgat
tggtatttttgtccgggaaccgagcagagatgttctgtccccgttgggccagtggatgtg
cagatccaaaactcatctgtgtcaccgtttggaaaactagtggtttacagctccattgat
gacagcgcctttaagcacaatggcacggtggagtgcagggcttacaacgatgtgggcaag
agttctgcctattttaactttgcatttaaaggtaacagcaaagaacaaatccatgcgcat
accctgttcacgcctttgctgattggttttgtgatcgcagctggtatgatgtgtatcatc
gtgatgattcttacatacaaatatttgcagaaacccatgtatgaagtacagtggaaggtt
gttgaggagataaatggaaacaattatgtttacatagacccaacgcaacttccttatgat
cacaaatgggagtttcccagaaacaggctgagttttgggaaaaccttgggtgcaggcgcc
ttcgggaaagttgttgaggccactgcatacggcctaattaagtcagatgcggccatgact
gttgctgtgaagatgctcaaaccaagtgcccatttaacggaacgagaagccctaatgtct
gaactcaaagtcttaagctacctcggtaatcatgtgaatattgtgaatcttcttggagca
tgcaccattggagggcccaccctggtcattacagaatattgttgctatggtgatcttctg
aattttttgagaagaaagcgtgattcatttatttgctcaaagcaggaagatcatgcagaa
gcggcactttataaaaaccttctccattcaaaggagtcttcctgcggtgatagtactaat
gagtacatggacatgaaacccggagtttcttatgttgtaccaaccaaggcagacaaaagg
agatctgcaagaataggttcatacatagaaagagacatgactcctgccatcatggaagat
gatgaattggccctagacctggaggacttgttgagcttttcttaccaggtggcaaagggc
atggcattccttgcctcaaagaattgtattcatagagacctggcagccagaaatatcctc
cttactcatggtcgaatcacaaagatttgtgattttggtctagccagagacatcaagaat
gattctaattatgtggtcaaaggaaacgctcggctacctgtgaagtggatggcaccggag
agcattttcaactgcgtgtacacgtttgaaagtgatgtctggtcctacgggatttttctg
tgggagctgttctctttaggcagcagcccctaccctggaatgccagtcgattctaaattc
tacaagatgatcaaggaaggcttccgaatgctcagccctgagcacgcacctgcggaaatg
tatgacatcatgaagacttgctgggatgctgatcccctgaaaaggccaacatttcagcag
attgtgcagctgattgagaagcagatttcagagagcaccaatcatatttattccaactta
gcgaactgcagcccccatcgggagacccccgcggtggaccgttccgtgcggatcaactcg
gtgggcagcagcgcgtcctccacgcagcctctgcttgtgcacgaagacgtctga

DBGET integrated database retrieval system