KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999132
Entry
102999132         CDS       T03086                                 

Gene name
SHC4
Definition
(RefSeq) SHC adaptor protein 4
  KO
K17449  SHC-transforming protein 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04722  Neurotrophin signaling pathway
bacu04910  Insulin signaling pathway
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05034  Alcoholism
bacu05100  Bacterial invasion of epithelial cells
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05220  Chronic myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102999132 (SHC4)
   04014 Ras signaling pathway
    102999132 (SHC4)
   04072 Phospholipase D signaling pathway
    102999132 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102999132 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102999132 (SHC4)
   04062 Chemokine signaling pathway
    102999132 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102999132 (SHC4)
   04915 Estrogen signaling pathway
    102999132 (SHC4)
   04917 Prolactin signaling pathway
    102999132 (SHC4)
   04926 Relaxin signaling pathway
    102999132 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    102999132 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102999132 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102999132 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102999132 (SHC4)
   05226 Gastric cancer
    102999132 (SHC4)
   05214 Glioma
    102999132 (SHC4)
   05220 Chronic myeloid leukemia
    102999132 (SHC4)
   05224 Breast cancer
    102999132 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    102999132 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102999132 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102999132 (SHC4)
   01522 Endocrine resistance
    102999132 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 102999132
NCBI-ProteinID: XP_007170503
UniProt: A0A383Z5R1
LinkDB
Position
Un
AA seq 630 aa
MRERGPDSLAGLVLYVGLFRHPGMLHRAKYSRFRNESITSLDEGSPGGSAGNKGSPQPPY
PALAPHLPPEDATLASQESPTPLCTLIPRIASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSLASPETSLNRAVPAPPPQRDALGHRATSLTPDACPLPGPGEPTPGSRQDKH
FLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCGAVPGANGAIKKRK
PPAKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECSNGMAQDVISTIGQAFELRFKQYLKNPSLNTSSESEEV
HVDDHAEEREDHEYYNEIPGKQPPAGGVSDVRIKVQATEQTAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNAHERGIQSQRDTSLMKPACRVDLFDDPCYINTQTLQSTLGSARN
QSPAHPLGSPWYREKAPETVQPGATAQPASSHSLPHIKQQLRNEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNLVLLRSNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggtccggacagcctggcaggactcgtgctgtatgtaggactcttcagg
caccccgggatgctgcacagggccaagtatagccgctttcggaacgagtccatcacgtcc
ttggacgaaggcagccccggaggctcggcggggaacaagggctcgccgcaacctccctac
cccgccctggcacctcacctgccgcctgaagatgccaccttggcgtcccaggagagcccc
accccactgtgcaccttgatccctcgcatagccagcgtaaagctggccaacccagccacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtacctcgactcaagctccag
gaaagccaggacccggctcccagcagcctggcttcccctgaaaccagtctgaatagggcc
gtgccagcacctccgcctcagcgggacgccctggggcacagggcgacctctttaactcct
gatgcctgcccccttcccggccctggggagccaacccccgggagcaggcaggacaagcac
tttctgcagcacctgttggggatgggcatgaactactatgtgaggtacatgggctgtatt
gaggtgctgcaatcaatgaggtcactggattttggcatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtggagctgtccctggggcaaatggagccattaaaaagcgaaag
cctccagctaagttcctatcaacagttcttggcaaaagtaatcttcagttttcgggaatg
aatataaaactgaccatctcaacatgcagcctcacactgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcttctggaggggatccggatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacatattg
gaatgcagcaatggaatggcccaagacgtcataagtaccatagggcaggcttttgaactc
cggtttaaacagtatttgaaaaatccttctttgaatacttcttctgaaagtgaggaagtg
cacgttgacgaccacgctgaggagagagaagatcatgagtattacaatgaaatcccgggc
aagcagccgcctgcaggtggtgtttcagatgtacggatcaaagttcaagctacagaacaa
acggcttactgccccatacggtgtgaaaagttgtgctatttgccgggaaactccaagtgc
agcagtgtgtatgagaactgtctagaacaaagcagggcaataggtaatgcacacgagaga
gggatacagtcccaacgagacacgtcattgatgaagcccgcgtgccgtgtggatctcttc
gacgacccctgctacatcaatacgcagactcttcaaagcacgctgggctctgccagaaat
caaagtccagctcacccactggggagcccatggtaccgtgaaaaggcaccagaaactgtt
cagccaggtgccacggcccagcctgccagctcacattctttgccacacattaagcagcag
ctgcggaatgaagactgctaccacggcaagctgagcaggaaagcagcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacatctcctggccaatatgtgctg
agtgggctacagggaggccaggcaaaacatcttctcctggtggatcccgaaggcaaggtg
aggaccaaggatcatgtatttgataatgtgggccaccttatcagataccacatggacaat
agtttgccaatcatctcttctggaagcgaagtaagccttaaacaaccagtgagaaaagat
aataatctagtacttttgcgttccaacaaatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006868
Entry
103006868         CDS       T03086                                 

Gene name
SHC2
Definition
(RefSeq) SHC adaptor protein 2
  KO
K17447  SHC-transforming protein 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04722  Neurotrophin signaling pathway
bacu04910  Insulin signaling pathway
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05034  Alcoholism
bacu05100  Bacterial invasion of epithelial cells
bacu05214  Glioma
bacu05220  Chronic myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103006868 (SHC2)
   04014 Ras signaling pathway
    103006868 (SHC2)
   04370 VEGF signaling pathway
    103006868 (SHC2)
   04072 Phospholipase D signaling pathway
    103006868 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103006868 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103006868 (SHC2)
   04062 Chemokine signaling pathway
    103006868 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103006868 (SHC2)
   04915 Estrogen signaling pathway
    103006868 (SHC2)
   04917 Prolactin signaling pathway
    103006868 (SHC2)
   04926 Relaxin signaling pathway
    103006868 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    103006868 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103006868 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103006868 (SHC2)
   05226 Gastric cancer
    103006868 (SHC2)
   05214 Glioma
    103006868 (SHC2)
   05220 Chronic myeloid leukemia
    103006868 (SHC2)
   05224 Breast cancer
    103006868 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    103006868 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103006868 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103006868 (SHC2)
   01522 Endocrine resistance
    103006868 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 103006868
NCBI-ProteinID: XP_007176718
UniProt: A0A383ZNN2
LinkDB
Position
Un
AA seq 426 aa
MGCIEVLRSMRSLDFSTRTQVTREAINRLHEAVPGIRGSWKKKAPNKALASILGKSNLRF
AGMSVAVSISIDGLNLSVPATRQXXTPHVAGTPPSAALSPQDMADYVAYVAKDPINQRAC
HILECCEGLAQSVISTVGQAFELRFKQYLHSPPRVVVPPGRLTGPEDLAWGDEDETEHNY
YNRTPGKEPPLGGLVDSRLTPAQQPCALGALGQGASPARRDARGPQWDVGPSAPPGDGYV
QADARGPRDYEDHLYVNTQGLDGPEPLQPEDSPKKDLFDMRPFEDALRLHECSVAAGPAA
APLPVEDQWPSPPTRRAPIAPTEEQLRQEPWYHGQMSRRAAEKLLRVDGDFLVRDSVTNP
GQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDYHLQNGQPIVAAESELHLRG
VVKREP
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgggctgcatcgaagtcctccgctcaatgcgctccctggacttcagcactcgcacccag
gtcaccagggaagccatcaaccggctccatgaggccgtgcctggcatccggggctcctgg
aagaagaaggcccccaacaaggcactggcctccatcctgggcaagagcaacctgcgcttc
gcgggcatgagcgtcgctgtcagcatctccatcgacggcctcaacctctccgttcccgcc
acgcgccaggnnnccaccccccacgttgctgggactccgccatccgctgccctctctccc
caggacatggcggattatgtggcctacgtggccaaggaccccatcaaccagagagcctgc
cacatcctggagtgctgcgagggcctcgcccagagcgtcatcagcaccgtgggccaagcc
ttcgagctgcgcttcaaacagtacctgcacagcccccccagggttgtcgtccccccggga
aggctgaccgggccggaggatttggcctggggggacgaggacgagacagaacacaactac
tacaaccgcactcccgggaaggagccgcccctgggcgggctggtggactccaggctcacc
cccgcgcagcagccctgtgccctcggggcccttggccagggagcatctcctgctcgaaga
gatgcccgaggcccgcagtgggacgtgggcccctcagccccgcccggggatggctacgtg
caggcagacgcccggggcccgcgagactacgaggaccacctgtacgtcaacacgcagggt
ctggacggcccggagcccctgcagcctgaggacagccccaagaaggacctgttcgacatg
agacccttcgaggatgccctgaggctgcacgagtgctccgtggccgcgggtccggcggca
gccccccttcccgtggaggaccagtggcccagcccgccgacccgccgggcccccatcgcc
cccacggaggagcagctgcggcaggagccctggtaccacggccagatgagccgtcgggcg
gcggagaaactgcttcgagtggacggggactttcttgtgcgggacagcgtcaccaacccc
gggcagtacgtcctcaccggcatgcacgcagggcagcccaagcacctgctgctcgtggac
cccgaaggcgtggtgcggacgaaggacgtgctcttcgagagcatcagccacctgatcgac
taccacctgcagaacgggcagcccatcgtggctgccgagagcgagctccacctgcgtggt
gtcgtcaagcgggaaccctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015382
Entry
103015382         CDS       T03086                                 

Gene name
SHC1
Definition
(RefSeq) SHC adaptor protein 1
  KO
K06279  SHC-transforming protein 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04722  Neurotrophin signaling pathway
bacu04910  Insulin signaling pathway
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05034  Alcoholism
bacu05100  Bacterial invasion of epithelial cells
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05220  Chronic myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103015382 (SHC1)
   04014 Ras signaling pathway
    103015382 (SHC1)
   04072 Phospholipase D signaling pathway
    103015382 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103015382 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103015382 (SHC1)
   04062 Chemokine signaling pathway
    103015382 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103015382 (SHC1)
   04915 Estrogen signaling pathway
    103015382 (SHC1)
   04917 Prolactin signaling pathway
    103015382 (SHC1)
   04926 Relaxin signaling pathway
    103015382 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    103015382 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103015382 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103015382 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103015382 (SHC1)
   05226 Gastric cancer
    103015382 (SHC1)
   05214 Glioma
    103015382 (SHC1)
   05220 Chronic myeloid leukemia
    103015382 (SHC1)
   05224 Breast cancer
    103015382 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    103015382 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103015382 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103015382 (SHC1)
   01522 Endocrine resistance
    103015382 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 103015382
NCBI-ProteinID: XP_007178531
UniProt: A0A383ZTY0
LinkDB
Position
Un
AA seq 584 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPMLPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRLGPKGEPGRAAEDGEGIAGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCDAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAPPGAARPTPPSAQTPSHLGATLPVGQPVGGDPEARKQMLPPPPCPAGR
ELFDDPSYVNVQNLDKARQAGGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQLVAM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaacccacttcggaatgagtctctgtcatcg
ctggaggagggagcttcagggtccaccccaccggaggagctgccttccccatcagcctcg
tctctggggcccatgctgccacctctgcctggggacgatagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaagctggccaacccggccgggggccgcctggggccg
aagggggagccaggaagggcagccgaggatggggaggggatcgcaggggcagccatgccg
gactcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgcgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgacgctgtgccg
ggtgctaagggggcaacaaggaggagaaagccctgtagccgtccactcagctccattctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaatctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatccatc
tcctttgcgtctggcggggacccggacacagccgagtatgtcgcctatgttgccaaagac
ccggtgaatcagagagcctgccacatcctggagtgtcccgaagggcttgctcaggacgtc
atcagcaccattggccaggccttcgagttgcgtttcaaacagtacctcaggaacccgccc
aagctggtcaccccccatgacaggatggctggctttgatggctcagcttgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttccctgggaaggaaccccctctt
gggggggtggtggacatgcggcttcgggaaggagcccccccgggggctgctcgacccact
ccacccagtgcccagacccctagccacctgggagccacgctgccagtggggcagcctgtt
ggaggagacccagaagcccgcaaacagatgctgcccccgccaccctgcccagcaggcaga
gagctctttgatgatccctcctatgtcaacgtccagaacctagacaaggcacggcaagca
ggcggtggagccgggccccccaatcctgccatcaatggcagcgcgccccgagacctcttt
gacatgaagccctttgaagatgccctgcgggtgcctccacctccccagttggtggccatg
gctgagcagctccgaggggagccctggtttcacgggaagctgagccggcgggaggccgag
gcactgctacagctcaacggggacttcctggtgcgggaaagcacgaccacgcctggccag
tatgtgctcactggcctgcagagtgggcagcccaagcacctgctactggtggaccctgag
ggtgtggttcggacaaaggatcaccgctttgagagtgtcagtcacctcatcagctaccac
atggacaatcacttgcccatcatctctgcgggcagcgaactgtgtctccagcaacctgtg
gagcggaaactgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017986
Entry
103017986         CDS       T03086                                 

Gene name
SHC3
Definition
(RefSeq) SHC adaptor protein 3
  KO
K17448  SHC-transforming protein 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04722  Neurotrophin signaling pathway
bacu04910  Insulin signaling pathway
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05034  Alcoholism
bacu05100  Bacterial invasion of epithelial cells
bacu05214  Glioma
bacu05220  Chronic myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103017986 (SHC3)
   04014 Ras signaling pathway
    103017986 (SHC3)
   04072 Phospholipase D signaling pathway
    103017986 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103017986 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103017986 (SHC3)
   04062 Chemokine signaling pathway
    103017986 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103017986 (SHC3)
   04915 Estrogen signaling pathway
    103017986 (SHC3)
   04917 Prolactin signaling pathway
    103017986 (SHC3)
   04926 Relaxin signaling pathway
    103017986 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    103017986 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103017986 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103017986 (SHC3)
   05226 Gastric cancer
    103017986 (SHC3)
   05214 Glioma
    103017986 (SHC3)
   05220 Chronic myeloid leukemia
    103017986 (SHC3)
   05224 Breast cancer
    103017986 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    103017986 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103017986 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103017986 (SHC3)
   01522 Endocrine resistance
    103017986 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 103017986
NCBI-ProteinID: XP_007193582
UniProt: A0A384B1T0
LinkDB
Position
Un
AA seq 461 aa
GDEPPPRAPHASDQVQGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVP
GAKGAFRKRKPPSKVLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMQSI
SFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQEVIGSIGQAFELRFKQYLQCPS
KIPTLHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMPPPGGFVDARLKARPHGPDTAQFA
GKEQTYYQGRHLGDTLGEDWQQTPVRQGSLDIYSMPERKSHVAPTGEAPTYVNTQCIPLQ
AGLAAGSSAESSPRKDLFDMKPFEDALKNQSLGPVLSKAASVECISPISPRAPDAKMLEE
LKAEPWYQGEMSRKEAEGLLKRDGDFLVRKSTTNPGSFVLTGMHNGQAKHLLLVDPEGTI
RTKDRIFDSINHLINHHLENSLPIVSAGSELCLQQPVERNP
NT seq 1386 nt   +upstreamnt  +downstreamnt
ggcgacgagccgccgccccgcgccccgcacgctagcgaccaggtgcagggggccggagtc
acctacgtcgtcaagtacttggggtgcattgaagttcttcgctcaatgaggtcacttgac
ttcagtacaaggacacaaattaccagggaagccatcagccgggtttgcgaagcggtccct
ggcgccaagggagccttcaggaaaagaaagcctccgagcaaagtgttgtccagcatcctg
ggcaagagcaacctccagtttgcggggatgagcatctccctgaccatatccaccgccagc
ctgaacctgcggaccccagactcgaaacagattatagcgaatcatcacatgcagtccatc
tccttcgcctctgggggagacccggatacaacagactacgttgcgtacgtagctaaggac
cctgttaatcgcagagcttgtcacattctggaatgttgtgacgggctggcccaggaggtc
atcggctccatcggacaagcctttgagctccggtttaagcaatatttgcagtgtccttcc
aagatccccactctccacgaccgaatgcagagtctagatgagccatggactgaagaggag
ggtgatggctcagaccacccgtactacaacagcattccaagcaagatgcctcctccaggg
gggtttgtagatgctcgactgaaagccagaccccacggtcctgacacagcccagtttgca
ggaaaagagcaaacttactaccaggggagacacttaggagacacgcttggcgaagactgg
cagcaaacacctgtcaggcaagggtctttggacatctacagcatgccggaaaggaaatcg
catgtggcccctacgggagaagcccccacctatgtcaacacccagtgtatcccgctgcag
gctgggctggccgcgggcagcagtgcagaaagcagcccacggaaagacctctttgacatg
aaacctttcgaagatgctctcaagaaccagtccttggggcctgtgttgagcaaggcagcc
tccgtggagtgcatcagccccatctcacccagagccccggatgccaagatgctggaagag
ctgaaagcagagccttggtaccaaggggagatgagcaggaaggaggcagaggggctactg
aagagagatggagacttcctggtcaggaagagcaccaccaacccaggctcctttgtcctc
actggcatgcacaacggccaggccaagcacctgctgctcgtggacccggaaggcacgatc
cggacaaaggacaggatctttgacagtatcaaccacctcatcaaccaccacctggagaac
agcctgcccatcgtctctgccgggagtgagctctgccttcagcagccggtggagaggaac
ccgtga

DBGET integrated database retrieval system