KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999133
Entry
102999133         CDS       T03086                                 

Gene name
ATF2
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04714  Thermogenesis
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999133 (ATF2)
   04668 TNF signaling pathway
    102999133 (ATF2)
   04022 cGMP-PKG signaling pathway
    102999133 (ATF2)
   04151 PI3K-Akt signaling pathway
    102999133 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102999133 (ATF2)
   04922 Glucagon signaling pathway
    102999133 (ATF2)
   04915 Estrogen signaling pathway
    102999133 (ATF2)
   04926 Relaxin signaling pathway
    102999133 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    102999133 (ATF2)
   04918 Thyroid hormone synthesis
    102999133 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    102999133 (ATF2)
   04925 Aldosterone synthesis and secretion
    102999133 (ATF2)
   04927 Cortisol synthesis and secretion
    102999133 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102999133 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    102999133 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    102999133 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102999133 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102999133 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    102999133 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    102999133 (ATF2)
   05031 Amphetamine addiction
    102999133 (ATF2)
   05034 Alcoholism
    102999133 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102999133 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102999133 (ATF2)
   05161 Hepatitis B
    102999133 (ATF2)
   05163 Human cytomegalovirus infection
    102999133 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    102999133 (ATF2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    102999133 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 102999133
NCBI-ProteinID: XP_007190490
UniProt: A0A384ASW3
LinkDB
Position
Un
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIVR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLTQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTTGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgtactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcctca
gaagacgacattaaaaaaatgcctctagatttatctcctcttgcaacacccatcgtaaga
agcaaaattgaggagccctctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgagaaggaagtaccattgacacaaactgcacagcctaca
tcagctatcgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacacag
gcaccgtcctccaacaggccaatcgttcctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttcgaatgtg
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccggga
attccaggtccttcctctcctcagccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggcgatactgtcaaaggtcatggtagc
ggactggttaggactcaatcagaggaatctcgaccacagtcattacaacagccagccaca
tccactacagaaactccggcttctccagctcacacaactccacagacccaaaatacaact
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaaggaggaagtttctggaa
agaaatagagcagcagcttcaagatgtagacagaaaagaaaagtctgggttcaatcttta
gaaaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagatgatagttcagaagac
ctgtcagtgccgagtagcccacatactgaagctatacagcatagttctgtcagcacatcc
aatggagtcagttcaacttccaaggcagaagctgtagccacttcagtcctcacgcagatg
gcggaccagagtacagagcctgcgctctcacagattgtcatggctccttcctcccagtca
cagccctcaggaagttga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999898
Entry
102999898         CDS       T03086                                 

Gene name
CREB3L2
Definition
(RefSeq) cAMP responsive element binding protein 3 like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04714  Thermogenesis
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04931  Insulin resistance
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102999898 (CREB3L2)
   04024 cAMP signaling pathway
    102999898 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    102999898 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    102999898 (CREB3L2)
   04152 AMPK signaling pathway
    102999898 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102999898 (CREB3L2)
   04922 Glucagon signaling pathway
    102999898 (CREB3L2)
   04915 Estrogen signaling pathway
    102999898 (CREB3L2)
   04926 Relaxin signaling pathway
    102999898 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    102999898 (CREB3L2)
   04918 Thyroid hormone synthesis
    102999898 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    102999898 (CREB3L2)
   04916 Melanogenesis
    102999898 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    102999898 (CREB3L2)
   04927 Cortisol synthesis and secretion
    102999898 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102999898 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102999898 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    102999898 (CREB3L2)
   04728 Dopaminergic synapse
    102999898 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    102999898 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102999898 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102999898 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    102999898 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102999898 (CREB3L2)
   05020 Prion disease
    102999898 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    102999898 (CREB3L2)
   05031 Amphetamine addiction
    102999898 (CREB3L2)
   05034 Alcoholism
    102999898 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102999898 (CREB3L2)
   04934 Cushing syndrome
    102999898 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102999898 (CREB3L2)
   05161 Hepatitis B
    102999898 (CREB3L2)
   05163 Human cytomegalovirus infection
    102999898 (CREB3L2)
   05165 Human papillomavirus infection
    102999898 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    102999898 (CREB3L2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102999898 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N JMY
Other DBs
NCBI-GeneID: 102999898
NCBI-ProteinID: XP_007177159
UniProt: A0A383ZQG3
LinkDB
Position
Un
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFAHVTASDSFNDDEVESEKWYLSTDF
PSTTIKTEPITDEPPSGLVPSVTLTITAISTPFEKEEPPLEMNAGVDSSCQTVIPKIKLE
PHEVDQFLNFSPKEASVDHLHLPPTPPSSHSSDSEGSLSPSPRLHPFGLPQTHSPARAPA
RAPSALASSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGTFFQGYGPYPSATKMALPNQHSMQEPYT
ASVVRSRNLLIYEEHSPLEEPSSSASAGELGRWDGGSSLLRASGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSTKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggaaaccgaggctctcatgtatcacacgcacttctcggagctgctg
gatgagttttcccagaacgtcttgggccagctcctgaacgaccctttcctctcagagaag
agtgtgtcgatggaggtagagccgtccccaacgtccccggcgcctctcattcaggccgag
cacagctactccctgtgtgaggagcctcgggcccagtcaccgttcgcccacgtcaccgcc
agtgacagcttcaatgatgatgaagtggagagtgagaaatggtacctgtctacagacttt
ccatcaacaaccatcaagacagagccaatcacggacgagccgccctcaggactagttccg
tctgtcactctgaccatcactgccatctccaccccttttgagaaggaggaaccccctctg
gaaatgaacgctggggttgattcctcgtgccagacagttattcctaagattaagctggaa
cctcatgaagtggatcagttcctcaacttctctcctaaggaagcctccgtggaccacctg
cacttaccgcccacccctcccagcagccacagcagcgactcggagggcagcctgagcccc
agcccgcgcctgcacccctttggcctgccgcagacccacagccccgccagggccccagcg
cgggccccctcggcacttgccagctccccactcctcaccgcaccgcacaagctgcaggga
tcaggccccctggtcctgacggaggaggagaagaggaccctgatcgccgagggctatccc
atccccaccaagctgcccctgacaaaatcagaggagaaggccctgaagaaaatccggagg
aaaatcaagaataagatttctgcccaggaaagtaggaggaagaagaaggaatacatggac
agcttggagaaaaaggtggagtcttgttcaacggagaacttggagcttcggaagaaggtg
gaggttctggagaacaccaacagaactctcctgcagcagctgcagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgcaagctggctggcacgcagactggcacctgcctc
atggttgttgtgttatgctttgccgttgcattcggcaccttctttcagggctatgggccc
tatccttctgccaccaagatggccctgcccaaccagcattccatgcaggagccctacaca
gcctccgttgtgagatccaggaacctgctgatctatgaggaacattctcccctggaggag
ccgtccagttcggcctcggctggggagctcgggcgctgggacggaggttcctccctgctc
agggcatcagggctggagtccaggcctgacgtggatcttccccatttcattatatcaaat
gagaccagcctggagaagtcagtgctgttggagctgcagcagcacttggtcagcaccaaa
ctggaggggaatgaaacactaaaagttgtagaactcgacagaagagtgaacgccaccttc
taa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001736
Entry
103001736         CDS       T03086                                 

Gene name
CREB3
Definition
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04714  Thermogenesis
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04931  Insulin resistance
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103001736 (CREB3)
   04024 cAMP signaling pathway
    103001736 (CREB3)
   04022 cGMP-PKG signaling pathway
    103001736 (CREB3)
   04151 PI3K-Akt signaling pathway
    103001736 (CREB3)
   04152 AMPK signaling pathway
    103001736 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103001736 (CREB3)
   04922 Glucagon signaling pathway
    103001736 (CREB3)
   04915 Estrogen signaling pathway
    103001736 (CREB3)
   04926 Relaxin signaling pathway
    103001736 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    103001736 (CREB3)
   04918 Thyroid hormone synthesis
    103001736 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    103001736 (CREB3)
   04916 Melanogenesis
    103001736 (CREB3)
   04925 Aldosterone synthesis and secretion
    103001736 (CREB3)
   04927 Cortisol synthesis and secretion
    103001736 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103001736 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103001736 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    103001736 (CREB3)
   04728 Dopaminergic synapse
    103001736 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    103001736 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103001736 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103001736 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    103001736 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103001736 (CREB3)
   05020 Prion disease
    103001736 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    103001736 (CREB3)
   05031 Amphetamine addiction
    103001736 (CREB3)
   05034 Alcoholism
    103001736 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103001736 (CREB3)
   04934 Cushing syndrome
    103001736 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103001736 (CREB3)
   05161 Hepatitis B
    103001736 (CREB3)
   05163 Human cytomegalovirus infection
    103001736 (CREB3)
   05165 Human papillomavirus infection
    103001736 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103001736 (CREB3)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103001736 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf FhuF_C
Other DBs
NCBI-GeneID: 103001736
NCBI-ProteinID: XP_007197040
UniProt: A0A384BBI8
LinkDB
Position
Un
AA seq 371 aa
MSHMELALDPGDHDLLGFLLEESGGLGAAPDEALEAPLGWELPLFEALSNWDVEDFLSCL
PSPPASLNVFSNSNPCLVHHDHTYSLSQEHVSIDLDNERYGEEGAQMTPLHVQEPAEQKP
QETARLILTEEEKRLLEKEGLTLPGTLPLTKMEEQVLKRVRRKIRNKKSAQESRRKKKVY
VGRLESRVLKYTAQNLELQNKVQLLEEENLSLLDQLRRLQAIMIQTANKASSGSTCVLVL
LFSFCLLFVPVMYSSDTRGSLPAEHGVLSRQLRALPSEDPPQLELPALQSEVPKDSLDHE
LQAPSNSCCLFYHMPQAPSAQPPLKLPQPDSFSTSSCPGPISPLHANLTSEGGWLSTHSS
TSVILLGRYSG
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgtctcatatggagctggcgttggacccgggtgaccatgacctgctgggcttcctgcta
gaggaaagcggaggtttgggggcggcgcccgatgaggccttggaggctccgctgggttgg
gagctgccactttttgaggctctgagcaattgggacgtagaggatttcctgagctgcctg
ccgagtcccccagcatcgttgaacgttttcagcaactctaacccctgtcttgtccaccat
gatcacacctattctctctcacaggagcatgtctccatagatctagataatgagagatat
ggagaagagggggctcagatgactccattgcatgtgcaggagccggcagagcagaaaccc
caggagactgctaggctaatactgactgaggaggagaagaggctcttggagaaggagggg
cttaccctgcctgggacgcttcctctcactaagatggaggaacaagttctgaaacgagtg
cggaggaagattcgaaacaaaaagtctgctcaggagagccgcaggaagaagaaggtgtat
gtggggcgtttagagagcagggtcctgaaatacacagcccagaatctggagctacagaac
aaagtacagctcctggaggaagagaatctgtcccttttggatcagttgaggagactccag
gccatcatgattcagacagcaaacaaagccagcagcggcagcacctgtgtcttggtcctg
ctgttctctttctgtctccttttcgtacctgtgatgtactcgtcggacacaagggggagc
ctgccagctgagcatggagtgttgtcccgccagcttcgtgccctccccagcgaggaccct
ccccagctggagctgcctgccctgcagtcagaggtaccaaaggacagcttggaccatgag
ctccaggctcctagcaattcttgctgcctcttctatcacatgcctcaagctcctagcgca
cagcctcccctgaagttgccacaacctgacagtttctcaacgtcctcctgcccaggtccc
atctctcccctgcatgcaaatctcacaagtgagggaggatggctctctacccacagctcc
acgtctgttatcttgctgggcagatattcaggctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003868
Entry
103003868         CDS       T03086                                 

Gene name
CREB3L4
Definition
(RefSeq) cAMP responsive element binding protein 3 like 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04714  Thermogenesis
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04931  Insulin resistance
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103003868 (CREB3L4)
   04024 cAMP signaling pathway
    103003868 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    103003868 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    103003868 (CREB3L4)
   04152 AMPK signaling pathway
    103003868 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103003868 (CREB3L4)
   04922 Glucagon signaling pathway
    103003868 (CREB3L4)
   04915 Estrogen signaling pathway
    103003868 (CREB3L4)
   04926 Relaxin signaling pathway
    103003868 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    103003868 (CREB3L4)
   04918 Thyroid hormone synthesis
    103003868 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    103003868 (CREB3L4)
   04916 Melanogenesis
    103003868 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    103003868 (CREB3L4)
   04927 Cortisol synthesis and secretion
    103003868 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103003868 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103003868 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    103003868 (CREB3L4)
   04728 Dopaminergic synapse
    103003868 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    103003868 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    103003868 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103003868 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    103003868 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103003868 (CREB3L4)
   05020 Prion disease
    103003868 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    103003868 (CREB3L4)
   05031 Amphetamine addiction
    103003868 (CREB3L4)
   05034 Alcoholism
    103003868 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103003868 (CREB3L4)
   04934 Cushing syndrome
    103003868 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103003868 (CREB3L4)
   05161 Hepatitis B
    103003868 (CREB3L4)
   05163 Human cytomegalovirus infection
    103003868 (CREB3L4)
   05165 Human papillomavirus infection
    103003868 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103003868 (CREB3L4)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103003868 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB HAUS-augmin3 DUF4200 MscS_porin EMP24_GP25L DUF3287 DUF724 ADIP
Other DBs
NCBI-GeneID: 103003868
NCBI-ProteinID: XP_007178589
UniProt: A0A383ZUK2
LinkDB
Position
Un
AA seq 395 aa
MDFRTPDLLEMWLEPPEDVFSTGSFLELGLHGPPSEVPVTRLQEQGLQGWESSGGHGFGL
QESEPEDFLKLFIDPNEVYRSEASPGSDSGISEDPRHPDSPPAPKPPSSPALYEVVYEAG
TLERMQGEAGPAVGLISIQIDQWSPPFMVPDACVVSEPPPDAHAHILPRAGTVNSVPPAA
LLPCQTLFLTEEEKHLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVTQLRQLQMLIVQTSNKAAQTSTCVLI
LLFSLALIILPSFSPLQGLPEAGPEDYQPHGVISRNILTHKDMTENLENPAVESRLEGPP
GAKGVNGSTRTLLEKTGGRAGPSRHIRTVLHADEM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatttcagaacccctgacctgctggaaatgtggctggagcctccagaagacgtcttc
tcaacaggatccttcctggagctgggactccatggtccaccttcagaggtcccagtaact
aggctacaggaacaggggctgcaaggctgggagtccagtgggggccatggctttggtctt
caagagagtgagcctgaagatttcctgaaacttttcattgatcccaatgaagtgtaccgc
tcagaagcatctcctggcagtgacagtggaatctctgaggatcctcgccatccagacagt
ccccctgcccccaagccacccagttcccctgccctctatgaggttgtctatgaggcaggg
accctggagaggatgcagggggaagctgggccagctgtagggctcatctccatccaaata
gatcagtggagcccaccatttatggtgcctgatgcctgtgtggtcagtgagccgcctccc
gatgctcatgcccacatcctgcccagagcaggcactgtaaactcagtgcctcccgcagcc
ctgctgccctgtcaaaccttgttcctgacagaagaggagaagcatctgctgggacaggaa
ggggtgtccctaccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtcagctcaggacagtcggcggcggaagaaagag
tacatcgatggactagagagcagggtagctgcctgttcagcgcagaaccaggaactacag
aaaaaagtccaggagctggagaggcacaacatctccctggtgactcagctccgccagctg
cagatgcttattgttcaaacctccaacaaagctgcccagactagcacttgtgttctgatc
cttcttttctccttggctctcatcatcctgcccagtttcagccccttacagggcttacca
gaagctgggcctgaggattaccagcctcatggagtgatttccagaaacatcctgactcac
aaggacatgacagaaaatctggagaatccagcggtagagtccagattggaggggccacct
ggggccaagggtgtaaatggctcaacaaggacactgcttgagaagacaggagggagggca
ggccccagccggcacatcagaactgtgctgcatgcagatgagatgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007680
Entry
103007680         CDS       T03086                                 

Gene name
CREB3L1
Definition
(RefSeq) cAMP responsive element binding protein 3 like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04714  Thermogenesis
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04931  Insulin resistance
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103007680 (CREB3L1)
   04024 cAMP signaling pathway
    103007680 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    103007680 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    103007680 (CREB3L1)
   04152 AMPK signaling pathway
    103007680 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103007680 (CREB3L1)
   04922 Glucagon signaling pathway
    103007680 (CREB3L1)
   04915 Estrogen signaling pathway
    103007680 (CREB3L1)
   04926 Relaxin signaling pathway
    103007680 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    103007680 (CREB3L1)
   04918 Thyroid hormone synthesis
    103007680 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    103007680 (CREB3L1)
   04916 Melanogenesis
    103007680 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    103007680 (CREB3L1)
   04927 Cortisol synthesis and secretion
    103007680 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103007680 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103007680 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    103007680 (CREB3L1)
   04728 Dopaminergic synapse
    103007680 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    103007680 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103007680 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103007680 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    103007680 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103007680 (CREB3L1)
   05020 Prion disease
    103007680 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    103007680 (CREB3L1)
   05031 Amphetamine addiction
    103007680 (CREB3L1)
   05034 Alcoholism
    103007680 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103007680 (CREB3L1)
   04934 Cushing syndrome
    103007680 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103007680 (CREB3L1)
   05161 Hepatitis B
    103007680 (CREB3L1)
   05163 Human cytomegalovirus infection
    103007680 (CREB3L1)
   05165 Human papillomavirus infection
    103007680 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103007680 (CREB3L1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103007680 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 103007680
NCBI-ProteinID: XP_007181202
UniProt: A0A384A1F6
LinkDB
Position
Un
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFGENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPIVPIKTEDTTQDVEHGAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATTPLLGLSPLTRLPIPHQAPGEMTQL
PVIKAEPQEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPIRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMATDSVYTASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPAEQRPQDHLQHDHLDSTHETSK
YLSEAWPKDVGGNSTSPDFSHPKEWFHERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtctgatttcctcaacaatgcgcacttccctgagcacctg
gaccactttggagagaacatggaggacttctccaacgacctgttcagcagtttctttgat
gaccccgtgctggacgagaagagccctctactggacatggaactggactcccccacgccg
ggcatccaggccgagcacagctactccctgagtggtgactcggcacctcagagccccatt
gtgcccatcaagacggaggacaccacccaagatgtggaacacggagcgtgggtgctggga
cacaaactgtgctccgtcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgcctcctcagccatggctgccgctgctgccatggccaccaccccgctgctgggc
ctcagccccctgaccaggctgcccatcccccaccaggccccgggagagatgactcagctg
ccagtgatcaaagcagagcctcaggaggtaaaccagttcctcaaagtgacaccagaggac
ctggtgcagatgcctccgacgccccccagcagccatggcagcgacagtgacggctcccag
agtccccgctctctgcccccctccagccccatccggcccatggcccgctcctccacagcc
atctccacctcccccctcctcactgcccctcacaaattacaggggacgtcagggccactg
ctcctgacggaggaggaaaagcgcaccctgattgctgagggctaccccatccccacgaaa
ctccccctcaccaaagctgaggagaaggccttaaagagggtccggaggaaaatcaagaac
aagatctcggcccaggagagccgccgtaagaagaaggagtacgtggagtgtctagaaaag
aaggtggagacctttacatccgagaacaacgaactgtggaagaaggtggagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggctgccacccagactgggacctgcctcatggtggcagcc
ttgtgcttcgtcctggtgctgggctccctcgtgccctgcctccctgagttctcctccggc
tcccagactgtgaaggaagaccccatggccactgacagcgtctacactgccagtcagatg
ccctcccgaagcctcctgttctatgatgagggggcaggctcgtgggaggatggccgcagc
gccctgctgcccgtggagcccccggatggctgggagatcaagcccggggggccggcggag
cagcgaccccaggaccacctgcagcatgaccacctggacagcacccacgagaccagcaag
tacctgagtgaggcctggcccaaggacgtcggtggaaacagcaccagtcctgacttctcc
caccctaaggagtggttccacgagagggatctgggccccaacaccaccatcaaactctcc
tag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009193
Entry
103009193         CDS       T03086                                 

Gene name
CREB5
Definition
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04714  Thermogenesis
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04931  Insulin resistance
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103009193 (CREB5)
   04024 cAMP signaling pathway
    103009193 (CREB5)
   04022 cGMP-PKG signaling pathway
    103009193 (CREB5)
   04151 PI3K-Akt signaling pathway
    103009193 (CREB5)
   04152 AMPK signaling pathway
    103009193 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103009193 (CREB5)
   04922 Glucagon signaling pathway
    103009193 (CREB5)
   04915 Estrogen signaling pathway
    103009193 (CREB5)
   04926 Relaxin signaling pathway
    103009193 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    103009193 (CREB5)
   04918 Thyroid hormone synthesis
    103009193 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    103009193 (CREB5)
   04925 Aldosterone synthesis and secretion
    103009193 (CREB5)
   04927 Cortisol synthesis and secretion
    103009193 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103009193 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103009193 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    103009193 (CREB5)
   04728 Dopaminergic synapse
    103009193 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    103009193 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    103009193 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103009193 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    103009193 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103009193 (CREB5)
   05020 Prion disease
    103009193 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    103009193 (CREB5)
   05031 Amphetamine addiction
    103009193 (CREB5)
   05034 Alcoholism
    103009193 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103009193 (CREB5)
   04934 Cushing syndrome
    103009193 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103009193 (CREB5)
   05161 Hepatitis B
    103009193 (CREB5)
   05163 Human cytomegalovirus infection
    103009193 (CREB5)
   05165 Human papillomavirus infection
    103009193 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103009193 (CREB5)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103009193 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 DivIC
Other DBs
NCBI-GeneID: 103009193
NCBI-ProteinID: XP_007193553
UniProt: A0A384B2M8
LinkDB
Position
Un
AA seq 502 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFNELDCSLEHEFRKAQEEESSKRNISMHNTVGGAMVGPGAHQLGSTRMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQQVSPATQQMQPTQTIQPPQPTGGRR
RRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKN
EVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPTCSQQQVIQHNTITTSSAVS
EVVGSSTLSQLTTHRTDLNPIL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaatttggagcaggagaggccgtttgtctgcagtgccccaggctgctcccagcgcttc
ccaacagaggaccatctgatgattcataggcacaagcatgaaatgactttgaagtttccc
tcaataaaaacagacaatatgttatcagatcagactccaaccccaacgagattcctgaag
aactgcgaggaggtggggctcttcaatgagctggactgctccctcgagcatgagttcagg
aaggctcaggaggaggagagcagcaagcggaatatctcgatgcataacaccgttggtggg
gccatggtggggcctggagctcaccagcttggcagcacccggatgcccaaccatgacacc
agcgttgtgattcagcaagccatgccgtcaccccagtccagctctgtcatcacacaggca
ccttccaccaaccgccagatcgggcctgtcccaggctctctatcttctctgctccatctt
cacaacagacagagacagcccatgccagcctccatgccagggaccctgcccaaccctaca
atgccgggctcttccgccgtcttgatgccaatggagagacaaatgtcagtgaactccaac
ctcctgggaatgcaaggtccaaatctcagcaacccctgtgcttctccccaagtccagcca
atgcattcagaagccaaaatgaggttgaaggctgcgttgactcaccaccctgctgccatg
tcaaatgggaatatgaacaccatgggacacatgatggaaatgatggggtcccgtcaggac
cagacgccacaccatcacatgcactcacacccacatcagcaccagacactgccagcccat
cacccctacccgcaccagcaccagcacccagcacaccatcctcatcctcagccccatcac
cagcagaaccacccacatcatcactcccactcccaccttcatgcacacccggcacatcac
cagacctcgccacacccacccctgcactccggcaaccaagcacagcaggtttcaccagcg
acacaacagatgcagcccacccagacaatacagccgcctcagcccacaggggggcgccgg
cgaagggtggtggatgaggatccggacgagaggcggcggaaatttctggaacggaaccgg
gcagccgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaa
gcagaagaactcacccagacaaacatgcaacttcagaatgaagtgtccatgttgaaaaac
gaggtggcacagctgaaacagctgttgttaacgcataaagactgccccataacagccatg
cagaaagaatcacaaggatatctaagtccagagagtagccctcctgcaagccccgtcccc
acgtgctctcagcagcaggtcatccagcataacaccatcaccacttcctcggccgtcagc
gaggtggtaggaagctccaccctcagtcagctcaccactcacagaacagacctgaatccg
attctctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014625
Entry
103014625         CDS       T03086                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04141  Protein processing in endoplasmic reticulum
bacu04151  PI3K-Akt signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04918  Thyroid hormone synthesis
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103014625 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103014625 (ATF6B)
   04022 cGMP-PKG signaling pathway
    103014625 (ATF6B)
   04151 PI3K-Akt signaling pathway
    103014625 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103014625 (ATF6B)
   04915 Estrogen signaling pathway
    103014625 (ATF6B)
   04926 Relaxin signaling pathway
    103014625 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    103014625 (ATF6B)
   04918 Thyroid hormone synthesis
    103014625 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    103014625 (ATF6B)
   04925 Aldosterone synthesis and secretion
    103014625 (ATF6B)
   04927 Cortisol synthesis and secretion
    103014625 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103014625 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    103014625 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    103014625 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103014625 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    103014625 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    103014625 (ATF6B)
   05031 Amphetamine addiction
    103014625 (ATF6B)
   05034 Alcoholism
    103014625 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103014625 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103014625 (ATF6B)
   05161 Hepatitis B
    103014625 (ATF6B)
   05163 Human cytomegalovirus infection
    103014625 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103014625 (ATF6B)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103014625 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 103014625
NCBI-ProteinID: XP_007193978
UniProt: A0A384B353
LinkDB
Position
Un
AA seq 714 aa
MVGGRGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEAAEEQTQLFLCPEQD
VPFGSSSLDLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQA
SGVGEVLVVKSESLTPSLCLLGDDPTSPFETVQINVGPTSDDPSDVQIKIEPVSPSSSIN
SEASLLSAESPSQAFIGEEVLEVKTESPSPQGCLLRDVSGPPLGAVQISMGLSSDGSSGK
PLPARKPPLQPKPVLITTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGL
TPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVS
ISEPPPAPISPRMSREEPRPQRHLLEFSAQEPVHGVEHPQHPSHGPKETQPSSTGPPSFR
NLTAFPGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRPQ
ERQKSQLWKKSPPVKAVPTQPPGPPERDSVGQLQLYRQPDRSQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSSTPGNATGGPLPASAASQAHQAARQPSTSIIPDLYDSH
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggttggggggcgggggggaaagatggcggagctgatgctcctcagcgagattgcggac
ccgacgcgctttttcaccgacaatttgctgagcccggaggactgggacagcaccttatac
gccggcctggatgaagcggccgaggagcaaacgcagctcttcctttgcccggagcaggat
gtcccgtttggcagcagttccctggacttggggatggatgtcagccctcctgaacccccc
tgggactctctgcctatcttcccagatcttcaggtgaagtctgagccatcctccccctgc
tcttcctcctccctcagctctgaatcgtcgcacctttctacagagccctccagccaggcc
tctggtgtaggggaggtgctggtcgtgaagtcagagtccttgacaccctcactctgcctc
ctgggagatgatccaacatccccatttgaaaccgtccagatcaatgtgggccccacctct
gatgatccctcagatgtccagattaagatagaacctgtctctccatcttcctccatcaac
tcggaggcttccctgctctctgcggagtcccccagccaggcttttataggagaggaggta
ctggaagtgaagacagagtccccatcccctcaagggtgtctcttgcgggatgtctcaggc
cccccacttggagctgtgcagatcagcatgggcctgtcctctgatggctcctcaggcaaa
cccctgcccgcccggaagccaccactgcagcccaaacctgtgttgataaccactgtcccg
atgccaccgagagccgtgcctcccagcaccactgtccttttgcagccccttgtccagcca
cccccagtgtccccagttgttctcatccaaggtgctattcgagtccagcctgagggactg
accccccctgctccacggcctgagaggaagagcattgttccagctcctatgcctgggaac
tcctgcccgcctgaggtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaac
cgggagtcggcctgccagtcccggaggaagaagaaagagtatctgcaggggctggaagct
cggctgcaggcggtgctggctgacaaccagcagctccggcgggagaatgctgccctccgc
cggcggctggaggccctgctggctgagaacagcgagctcaagttagggtctggaaacagg
aaggtggtctgcatcatggtcttccttctcttcattgccttcaacttcgggcctgtcagc
atcagtgagcctcctccagctcccatctctcctcggatgagcagagaggagcctcgaccc
cagagacacttgctggagttctcggcgcaagagccagttcacggagtcgagcacccccag
catccctcccacggtcccaaggagacccagcccagctccacgggccccccaagtttcagg
aacctgacagccttccctgggggcaccaaggagctgctgctgagagacctggaccagctc
ttcctctcctctgattgccggcacttcaaccgaaccgagtccctgaggcttgctgatgag
ctgagtggctgggtccagcgccaccagagaggccggcggaagatcccccagaggccccag
gagagacagaagtctcagctatggaagaagtcgcctccagttaaggcagtccccacccaa
ccccctgggcccccggaaagggattctgtgggccagctgcagctatatcgccaaccagac
cgttcgcagccggagttcctggatgcaattgaccgacgggaagacacattttatgttgtc
tccttccgaagggaccacttgctgctcccagccatcagccacaacaagacctctcggccc
aagatgtccctggtgatgcccgccatggcccccaatgagaccctgtcaggccgggggccc
ccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgatt
cacatcaagacctccacagtgcccccctcgctccgaaaacagccgtcctcaaccccgggc
aatgccacaggtggccccttgccagcttctgcagccagccaggcccaccaggccgcccgt
cagccctctacctcaatcatccctgacctctacgactcacactga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017577
Entry
103017577         CDS       T03086                                 

Gene name
CREB1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04380  Osteoclast differentiation
bacu04612  Antigen processing and presentation
bacu04668  TNF signaling pathway
bacu04710  Circadian rhythm
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04931  Insulin resistance
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103017577 (CREB1)
   04024 cAMP signaling pathway
    103017577 (CREB1)
   04022 cGMP-PKG signaling pathway
    103017577 (CREB1)
   04151 PI3K-Akt signaling pathway
    103017577 (CREB1)
   04152 AMPK signaling pathway
    103017577 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    103017577 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    103017577 (CREB1)
   04922 Glucagon signaling pathway
    103017577 (CREB1)
   04915 Estrogen signaling pathway
    103017577 (CREB1)
   04926 Relaxin signaling pathway
    103017577 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    103017577 (CREB1)
   04918 Thyroid hormone synthesis
    103017577 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    103017577 (CREB1)
   04916 Melanogenesis
    103017577 (CREB1)
   04924 Renin secretion
    103017577 (CREB1)
   04925 Aldosterone synthesis and secretion
    103017577 (CREB1)
   04927 Cortisol synthesis and secretion
    103017577 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103017577 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103017577 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    103017577 (CREB1)
   04728 Dopaminergic synapse
    103017577 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103017577 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    103017577 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    103017577 (CREB1)
   04713 Circadian entrainment
    103017577 (CREB1)
   04714 Thermogenesis
    103017577 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103017577 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    103017577 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103017577 (CREB1)
   05020 Prion disease
    103017577 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    103017577 (CREB1)
   05031 Amphetamine addiction
    103017577 (CREB1)
   05034 Alcoholism
    103017577 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103017577 (CREB1)
   04934 Cushing syndrome
    103017577 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103017577 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017577 (CREB1)
   05161 Hepatitis B
    103017577 (CREB1)
   05163 Human cytomegalovirus infection
    103017577 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103017577 (CREB1)
   05165 Human papillomavirus infection
    103017577 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103017577 (CREB1)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103017577 (CREB1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103017577 (CREB1)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    103017577 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 103017577
NCBI-ProteinID: XP_007167085
UniProt: A0A452C4R9
LinkDB
Position
Un
AA seq 341 aa
MTMESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaagccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtgtcc
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtgcagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaaccgat
tcccaaaaacgaagagaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccgatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcagacattaaccatgaccaatgcagctgccactcagccgggtactacc
atcctgcagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacaaacataccagattcgcacagcacccactagc
accattgcccctggagttgttatggcgtcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgcctcatgaagaacagggaagcagcacgagaatgt
cgtagaaagaagaaagaatatgtgaaatgtctagaaaacagagtggcagtgcttgaaaac
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017770
Entry
103017770         CDS       T03086                                 

Gene name
ATF4
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04137  Mitophagy - animal
bacu04141  Protein processing in endoplasmic reticulum
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04932  Non-alcoholic fatty liver disease
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103017770 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017770 (ATF4)
   04668 TNF signaling pathway
    103017770 (ATF4)
   04022 cGMP-PKG signaling pathway
    103017770 (ATF4)
   04151 PI3K-Akt signaling pathway
    103017770 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103017770 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    103017770 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103017770 (ATF4)
   04922 Glucagon signaling pathway
    103017770 (ATF4)
   04912 GnRH signaling pathway
    103017770 (ATF4)
   04915 Estrogen signaling pathway
    103017770 (ATF4)
   04926 Relaxin signaling pathway
    103017770 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    103017770 (ATF4)
   04918 Thyroid hormone synthesis
    103017770 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    103017770 (ATF4)
   04925 Aldosterone synthesis and secretion
    103017770 (ATF4)
   04927 Cortisol synthesis and secretion
    103017770 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103017770 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    103017770 (ATF4)
   04728 Dopaminergic synapse
    103017770 (ATF4)
   04720 Long-term potentiation
    103017770 (ATF4)
   04722 Neurotrophin signaling pathway
    103017770 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    103017770 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103017770 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    103017770 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103017770 (ATF4)
   05012 Parkinson disease
    103017770 (ATF4)
   05014 Amyotrophic lateral sclerosis
    103017770 (ATF4)
   05020 Prion disease
    103017770 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    103017770 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    103017770 (ATF4)
   05031 Amphetamine addiction
    103017770 (ATF4)
   05034 Alcoholism
    103017770 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103017770 (ATF4)
   04934 Cushing syndrome
    103017770 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017770 (ATF4)
   05161 Hepatitis B
    103017770 (ATF4)
   05163 Human cytomegalovirus infection
    103017770 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103017770 (ATF4)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103017770 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4795 Fez1 DUF4407 Nop53 bZIP_Maf ZapB
Other DBs
NCBI-GeneID: 103017770
NCBI-ProteinID: XP_007189150
UniProt: A0A384AP78
LinkDB
Position
Un
AA seq 352 aa
MAEMSFLSSEVLVGDFMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSGDKAKAGFSE
WLAVDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDFNALLGIDDLETMPDELLATLDDTC
DLFDPLLQEANKEPPQIVNPIGHLPESLPTTDQGAPFTFLQPLPLSPGALSSTPDHSFTL
ELCSEVVISEEDRKPDSTAYVTVHPQCVKEEDAPSDNDSGICMSPDSYLGSPQHSPPTSR
GSPNRSLLSPGAPGGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKK
RAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRIP
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccgagatgagcttcctgagcagcgaggtgttggtgggggacttcatgtcccccttc
gaccagtcgggtttgggggctgaagagagcctgggtctcctagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctctggcgacaaggctaaggcgggcttctccgaa
tggctggctgtggatgggttggtcagtgcctcagataacggcaaggaggatgctttctct
gggacagattggatggtggagaaaatggatctgaaggagtttgattttaatgctctgttg
ggtatagatgatctggaaaccatgccagatgagcttttggccacgttggatgacacgtgt
gatctttttgaccccctactccaggaggctaataaggagcccccccagatagtgaaccca
ataggccatcttccagaaagtttgccaacaactgaccagggtgcccctttcactttctta
cagcctcttcctctgtccccaggggccctgtcctccactccagatcattcttttacttta
gagctatgcagtgaagtggtgatctctgaagaagataggaagccagactccactgcttac
gttacagtgcaccctcagtgcgtaaaggaagaggatgccccttcagataatgatagtggc
atctgtatgagccctgactcctatctgggctctccccagcatagcccccctacctcaagg
ggctctccgaatagaagcctgctatctccaggtgcccctggtggctctgcccgccccaaa
ccctacgaccctcctggagagaagatggtagcagcaaaagtaaagggtgagaaactagat
aagaaactgaagaaaatggagcagaacaagacagcagccactaggtatcgccagaagaag
agggcagagcaggaggccctcactggtgaatgtaaagagctagaaaagaagaatgaggct
ctgaaagagaaggcagattccttggccaaggagatccagtatctgaaagatttaatagaa
gaggtccgcaaggcaagggggaagaagagaatcccctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018056
Entry
103018056         CDS       T03086                                 

Gene name
CREB3L3
Definition
(RefSeq) cAMP responsive element binding protein 3 like 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04714  Thermogenesis
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04922  Glucagon signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04931  Insulin resistance
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103018056 (CREB3L3)
   04024 cAMP signaling pathway
    103018056 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    103018056 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    103018056 (CREB3L3)
   04152 AMPK signaling pathway
    103018056 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103018056 (CREB3L3)
   04922 Glucagon signaling pathway
    103018056 (CREB3L3)
   04915 Estrogen signaling pathway
    103018056 (CREB3L3)
   04926 Relaxin signaling pathway
    103018056 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    103018056 (CREB3L3)
   04918 Thyroid hormone synthesis
    103018056 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    103018056 (CREB3L3)
   04916 Melanogenesis
    103018056 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    103018056 (CREB3L3)
   04927 Cortisol synthesis and secretion
    103018056 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103018056 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103018056 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    103018056 (CREB3L3)
   04728 Dopaminergic synapse
    103018056 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    103018056 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103018056 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103018056 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    103018056 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103018056 (CREB3L3)
   05020 Prion disease
    103018056 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    103018056 (CREB3L3)
   05031 Amphetamine addiction
    103018056 (CREB3L3)
   05034 Alcoholism
    103018056 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103018056 (CREB3L3)
   04934 Cushing syndrome
    103018056 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103018056 (CREB3L3)
   05161 Hepatitis B
    103018056 (CREB3L3)
   05163 Human cytomegalovirus infection
    103018056 (CREB3L3)
   05165 Human papillomavirus infection
    103018056 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103018056 (CREB3L3)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103018056 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 ZapB DUF1664
Other DBs
NCBI-GeneID: 103018056
NCBI-ProteinID: XP_007169237
UniProt: A0A383Z2B7
LinkDB
Position
Un
AA seq 457 aa
MNGDSAVGKMASSTSLTCPIDSLELLDLLFDRQDGILRHVELGEDWGHVEDQVLPGPNSD
DFLNSILGSGESVPSSPTWSPAASDSGISEDLPSDPQDTPPHSGVAATPASCHSAESGKG
PCPSYHPGPACPTRNLGPVAQGLEASVAIDLEMWSPGLYAGEQAELASSPPHCNLTVKDL
LLSGSGGDLQHHLAAPNLLRLGTGHSQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVL
KKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLK
KLQAIVVQSTSKSAQTGTCIAVLLFSFALIILPSISPFASNKAESPGDFVPVRVFSRTLH
NDAASRVAPKTVPGSETPGHGPKAATLQEGSPSSPQEEWGSRDPPAPDNSTEDLDNGTLV
QGNSMKELDRTTLLDCAQPEQALGPGRMGLEVAGGEL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaatggggattcagcagttggaaagatggcttcctccaccagtctcacgtgccctatc
gacagcctggaactcttggatctcctgtttgaccggcaggacggcatcctgagacacgta
gagctgggcgaggactggggccacgttgaggaccaggtcctgccaggcccgaactctgat
gatttcctcaactccatcctgggttctggagaatcagtgcccagctccccgacctggtct
cctgcggccagtgacagtggcatctcagaagatctgccctccgacccccaggacacccct
ccacacagtggggtggctgccaccccggccagctgccacagcgcggagtctggcaagggg
ccctgcccctcctaccatcctggccctgcctgccccaccaggaaccttgggccagtggcc
caagggcttgaggcttccgtggctatagacctggaaatgtggagcccaggcctctacgcc
ggggagcaggctgagctggccagctcacccccgcactgcaacctcacagtgaaagacctc
ctcctctctggcagtggcggggacctgcaacatcacctggcagcccccaacctgttgcgc
cttgggaccgggcacagccaggagctggtgctgacggaggacgagaagaagctgctggcc
aaagaaggcatcaccctgcccacccagctgcccctcaccaagtatgaggagcgagtgctg
aaaaaaatccgccggaaaattcggaacaaacagtcagcccaagaaagccggaaaaagaag
aaggaatatattgatggcctggaaactcggatgtcagcctgcactgcccagaaccaggaa
cttcagaggaaggtcttgcatcttgagaagcagaacctgtccctcttggagcagctgaag
aaactccaggccatcgtggtccagtccaccagcaagtcggctcagacgggcacctgcata
gcggtcctgctcttctccttcgccctcatcatcctcccctccatcagccctttcgcctcc
aacaaagccgagagccccggagactttgtgcctgtacgagttttctccagaactttgcac
aacgatgctgcatcccgtgtggctcccaaaaccgtgccaggctccgaaaccccaggacat
gggcccaaggctgccacacttcaggaagggtctccaagcagccctcaggaggaatgggga
tcccgggacccgccggctccggacaactcgacggaggatctggacaacgggaccctggtc
cagggcaactccatgaaggagctggaccggaccaccctcctagactgtgcccagcctgaa
caagcactcggcccagggcgcatggggctggaggtggcagggggtgagctgtga

DBGET integrated database retrieval system