KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999196
Entry
102999196         CDS       T03086                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04062  Chemokine signaling pathway
bacu04068  FoxO signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04714  Thermogenesis
bacu04722  Neurotrophin signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05034  Alcoholism
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999196 (SOS1)
   04012 ErbB signaling pathway
    102999196 (SOS1)
   04014 Ras signaling pathway
    102999196 (SOS1)
   04630 JAK-STAT signaling pathway
    102999196 (SOS1)
   04068 FoxO signaling pathway
    102999196 (SOS1)
   04072 Phospholipase D signaling pathway
    102999196 (SOS1)
   04151 PI3K-Akt signaling pathway
    102999196 (SOS1)
   04150 mTOR signaling pathway
    102999196 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102999196 (SOS1)
   04540 Gap junction
    102999196 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102999196 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102999196 (SOS1)
   04660 T cell receptor signaling pathway
    102999196 (SOS1)
   04662 B cell receptor signaling pathway
    102999196 (SOS1)
   04664 Fc epsilon RI signaling pathway
    102999196 (SOS1)
   04062 Chemokine signaling pathway
    102999196 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102999196 (SOS1)
   04912 GnRH signaling pathway
    102999196 (SOS1)
   04915 Estrogen signaling pathway
    102999196 (SOS1)
   04917 Prolactin signaling pathway
    102999196 (SOS1)
   04926 Relaxin signaling pathway
    102999196 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    102999196 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102999196 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102999196 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999196 (SOS1)
   05206 MicroRNAs in cancer
    102999196 (SOS1)
   05205 Proteoglycans in cancer
    102999196 (SOS1)
   05231 Choline metabolism in cancer
    102999196 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102999196 (SOS1)
   05225 Hepatocellular carcinoma
    102999196 (SOS1)
   05226 Gastric cancer
    102999196 (SOS1)
   05214 Glioma
    102999196 (SOS1)
   05221 Acute myeloid leukemia
    102999196 (SOS1)
   05220 Chronic myeloid leukemia
    102999196 (SOS1)
   05211 Renal cell carcinoma
    102999196 (SOS1)
   05215 Prostate cancer
    102999196 (SOS1)
   05213 Endometrial cancer
    102999196 (SOS1)
   05224 Breast cancer
    102999196 (SOS1)
   05223 Non-small cell lung cancer
    102999196 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    102999196 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102999196 (SOS1)
   05160 Hepatitis C
    102999196 (SOS1)
   05163 Human cytomegalovirus infection
    102999196 (SOS1)
   05165 Human papillomavirus infection
    102999196 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102999196 (SOS1)
   01522 Endocrine resistance
    102999196 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    102999196 (SOS1)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102999196 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N PH PH_19 PH_10 PH_13 IQ_SEC7_PH Mcp5_PH
Other DBs
NCBI-GeneID: 102999196
NCBI-ProteinID: XP_007167190
UniProt: A0A383YWD3
LinkDB
Position
Un
AA seq 1001 aa
MHPSLHFGTSADSGTYIRNQCGDNAKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICS
KSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTR
VGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKH
AFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSA
DVYRFAEPDSEENIIFEENVQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYR
SFCKPQELLSLLIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNV
CRHWVEHHFYDFERDADLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNI
TFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKE
DKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFNGVL
EVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGI
YLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFE
NLNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRH
PTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSP
FHSSSDTVFIQVTLPHGPRSASVSSISLTKSTDEVPVPPPVPPRRRPESAPAESSPSKIM
SKHLDSPPAIPPRQPTSKAYSPRYSVSDRTSISDPPESPPLLPPREPVRTPDVFSSSPLH
LQPPPLGKKSDHSNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPV
PPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
NT seq 3006 nt   +upstreamnt  +downstreamnt
atgcatccaagtctccattttgggacctcagcagattcagggacttacataaggaaccag
tgtggggataacgccaaacagttagaagaaaagagtgaagatcaagaagacaaggaatgt
ttgaaacaagcaataacagctttgcttaatgttcagagtggtatggaaaaaatatgttct
aaaagccttgcaaaacgaagactgagtgaatctgcatgtcggttttatagtcagcaaatg
aaggggaaacaactagcaatcaagaaaatgaacgagattcagaagaatattgatggttgg
gagggaaaagacattggacagtgttgcaatgagtttataatggaaggaactcttacacgt
gtaggagccaaacatgagagacacatatttctctttgatggcttaatgatttgctgtaaa
tcaaatcatgggcagccaagacttcctggtgctagcaatgcagaatatcgtcttaaagaa
aagttttttatgagaaaggtacaaattaatgacaaagatgacaccaatgagtacaagcat
gcttttgaaataattttgaaagatgaaaatagcgttatattttctgccaagtcagctgaa
gagaaaaacaattggatggcagcattgatatctttacagtaccggagtacactggaaagg
atgcttgacgtgacaatgctccaggaagaaaaggaggagcagatgaggctccccagtgct
gatgtgtatagatttgcagagcctgactctgaagaaaatatcatatttgaagagaacgtg
cagcccaaagctggaattccaattatcaaagcaggaactgttattaaacttatagagagg
ctcacataccatatgtacgcagatcccaattttgttcggacatttcttacaacatataga
tccttttgtaaacctcaagaactactgagtcttttaatagaaaggtttgaaattccagag
cctgagccaacagaagctgatcgcatagctatagagaatggagatcagcccttgagtgca
gaactaaaaaggtttagaaaagaatatatacagcctgtacaactgcgagtattaaatgta
tgtcggcactgggtagagcaccacttctacgattttgaaagagacgcagatcttttgcag
cgaatggaggaatttattggaacagtaagaggtaaagcaatgaaaaagtgggttgaatcc
atcactaaaataatccaaaggaaaaaaattgcaagagacaatggaccaggtcataatatt
acatttcagagttcacctcccacagttgagtggcatataagcagacctgggcacatagag
acttttgacctgctcaccttacacccaatagaaattgctcgacaactcactttacttgaa
tcagatctatatcgagctgtacagccatcagaattagttggaagtgtgtggacaaaggaa
gacaaagaaattaattctcctaatcttctgaaaatgatccggcataccactaatctcact
ctgtggtttgagaaatgtattgtagaaactgaaaacttagaagaaagagtagctgtggtg
agtcgaataattgagattctgcaagtctttcaagagctgaacaacttcaatggtgtcctt
gaggttgtcagtgctatgaactcatcacctgtatacagactagaccacacgtttgagcaa
ataccaagtcgccaaaagaaaattttagaagaagctcatgaactaagtgaagatcactat
aagaaatatttggcaaaactcaggtctattaatccaccatgtgtgcctttctttggaatt
tatctaactaatatcttgaaaacagaagaaggcaaccctgaggtcctaaaaaggcatgga
aaagagcttataaactttagcaaaaggaggaaagtagcagaaataacaggcgagatccag
cagtaccaaaatcagccttattgtttacgagtagaatcagatatcaaaaggttctttgaa
aacttgaatccaatgggaaatagtatggaaaaagaatttacagattatcttttcaacaaa
tccctagaaatagaaccacgaaaccctaagcctctcccaagatttccaaaaaaatatagc
tatcccctaaaatctcctggtgttcgtccatcaaacccaagaccaggtactatgagacat
cccacacctctgcagcaagagccaaggaaaattagttatagtaggatccctgaaagtgaa
acggaaagtacagcatctgcaccaaattctccaagaacaccgttaacacctcctcctgct
tctggtgcttctagtaccacagatgtttgcagcgtatttgactctgatcattcaagccct
tttcactcaagcagcgataccgtctttatccaagttacactgccccatggcccaagatct
gcttcagtatcatctataagtttaaccaagagcactgatgaagtgcctgtcccccctcct
gttcctccacgaagacgaccagaatctgccccagcggaatcttcgccatctaagatcatg
tctaaacatttggacagccccccagcaattcctcctaggcaacccacatcaaaagcctat
tcaccacgatattcagtatcagaccggacctctatatcagatcctcctgaaagccctccc
ttattacctccacgagaacccgtgaggacacctgatgttttctcaagctcaccactacat
ctccaacctccccctttgggcaaaaaaagtgaccatagtaatgccttcttcccaaacagc
ccttccccctttacaccacctccgcctcaaacaccttctcctcacggcacaagaaggcat
ctgccatcaccaccactgacacaagaagtggaccttcattccattgctgggccgcctgtt
cctccacgacaaagcacttctcaacatatccctaaactccctccaaaaacttacaaaagg
gagcatacacacccatccatgcacagagacggaccaccgctgttggagaatgcccattct
tcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019365
Entry
103019365         CDS       T03086                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04062  Chemokine signaling pathway
bacu04068  FoxO signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04714  Thermogenesis
bacu04722  Neurotrophin signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05034  Alcoholism
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103019365 (SOS2)
   04012 ErbB signaling pathway
    103019365 (SOS2)
   04014 Ras signaling pathway
    103019365 (SOS2)
   04630 JAK-STAT signaling pathway
    103019365 (SOS2)
   04068 FoxO signaling pathway
    103019365 (SOS2)
   04072 Phospholipase D signaling pathway
    103019365 (SOS2)
   04151 PI3K-Akt signaling pathway
    103019365 (SOS2)
   04150 mTOR signaling pathway
    103019365 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103019365 (SOS2)
   04540 Gap junction
    103019365 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103019365 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103019365 (SOS2)
   04660 T cell receptor signaling pathway
    103019365 (SOS2)
   04662 B cell receptor signaling pathway
    103019365 (SOS2)
   04664 Fc epsilon RI signaling pathway
    103019365 (SOS2)
   04062 Chemokine signaling pathway
    103019365 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103019365 (SOS2)
   04912 GnRH signaling pathway
    103019365 (SOS2)
   04915 Estrogen signaling pathway
    103019365 (SOS2)
   04917 Prolactin signaling pathway
    103019365 (SOS2)
   04926 Relaxin signaling pathway
    103019365 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    103019365 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103019365 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103019365 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019365 (SOS2)
   05206 MicroRNAs in cancer
    103019365 (SOS2)
   05205 Proteoglycans in cancer
    103019365 (SOS2)
   05231 Choline metabolism in cancer
    103019365 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103019365 (SOS2)
   05225 Hepatocellular carcinoma
    103019365 (SOS2)
   05226 Gastric cancer
    103019365 (SOS2)
   05214 Glioma
    103019365 (SOS2)
   05221 Acute myeloid leukemia
    103019365 (SOS2)
   05220 Chronic myeloid leukemia
    103019365 (SOS2)
   05211 Renal cell carcinoma
    103019365 (SOS2)
   05215 Prostate cancer
    103019365 (SOS2)
   05213 Endometrial cancer
    103019365 (SOS2)
   05224 Breast cancer
    103019365 (SOS2)
   05223 Non-small cell lung cancer
    103019365 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    103019365 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103019365 (SOS2)
   05160 Hepatitis C
    103019365 (SOS2)
   05163 Human cytomegalovirus infection
    103019365 (SOS2)
   05165 Human papillomavirus infection
    103019365 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103019365 (SOS2)
   01522 Endocrine resistance
    103019365 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    103019365 (SOS2)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103019365 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 103019365
NCBI-ProteinID: XP_007192876
UniProt: A0A384AZK3
LinkDB
Position
Un
AA seq 1272 aa
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEHEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRLGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGNASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGTMKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPL
HSPPPPPPRDPFPDTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLSSSQNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3819 nt   +upstreamnt  +downstreamnt
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccatgtgtccctatatattgtggctgtactagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatcccaacag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctttgtgaagatgaacctagttcttcaggtgaattaaactactat
gaccttgtcagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttctttctgacagaaagctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgaattgaccgtgaaacttttaggttta
attgaagacacagttgaaatgactgatgaaagcagccctcatcccttagctggaagctgt
tttgaagatttggcagaggaacaagcatttgatccttatgaaacattatcacaggatatt
ctttcaccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgccagtatatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcatgaagacagagaatgtttgaaccaagctattactgctctcatgaat
ctccaaggtagtatggaccgaatttacaagcagtattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaatttattatggaaggcccattgacaagaattggtgctaaacacgaacggcatattttt
ctctttgatggcttaatgattagctgcaaacccaatcatagccagtcacgccttccagga
tacagtagtgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgcgagtgcaaacatgcttttgaattagtatccaaagatgaaaac
agcataatatttgctgctaagtctgctgaagagaaaaataattggatggcagcacttatt
tctcttcattatcgtagtactctagatcgaatgctagattcagtattattgaaggaagaa
aatgaacaaccacttagattaccgagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggttaacatatcacatgtatgcagatcctaat
tttgttcgcacttttcttactacgtatcgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
gtagagaaaggcgagcagccaatcagtgcagaccttaaaaggtttcgcaaggaatacgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagacttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagactaggacagtttgaaacgtttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacacttttggaatctgatctctacaggaaagttcaaccttct
gaacttgtagggagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccacaccacaaatctcactctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcagtactaagtagaattatagaaattctgcaagttttt
caagatctgaataatttcaatggtgtattagagatcgtcagtgcagtaaattcagtatca
gtctatagactagatcatacctttgaggcattgcaggaaagaaaaaggaaaattttggat
gaagctgtggaattaagtcaagatcattttaaaaaatatctagtgaaacttaagtcgatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaacttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcaatatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaaccccatgggaaatgcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggtactttacgaggtcatccaacaccattagaa
agagaaccatgtaaaataagctttagtcggattgctgaaacagagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggaagcaatagcatctttgctcca
gtcctcttgcctcattcaaagtctttctttagttcgtgtggtagtttacataaactaagt
gaagagccactgattcctcctccacttcctcctcgaaaaaaatttgatcatgatgcttca
aattccaagggaactatgaaatctgatgatgacccccctgctattccgccaagacagcct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcatttgacgggcctctg
catagtccaccaccgccgccgccgagagatccttttcccgatacccctccaccagttccc
cttcggcctccagaacactttataaactgtccgtttactcttcagccacctccgctggga
catcttcacagagatccagactggttcagagacgttagtacgtgtccaaattctccaaac
actcctcctagcacaccctctccaagggtaccacgtcgatgctatgtgctcagttctagt
caaaataatcttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttacaaacgggagctttcgcaccccccattgtat
agactgcctttgctagaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system