KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999215
Entry
102999215         CDS       T03086                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04932  Non-alcoholic fatty liver disease
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05134  Legionellosis
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05222  Small cell lung cancer
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102999215
   04215 Apoptosis - multiple species
    102999215
   04115 p53 signaling pathway
    102999215
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999215
  09162 Cancer: specific types
   05210 Colorectal cancer
    102999215
   05222 Small cell lung cancer
    102999215
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102999215
   05012 Parkinson disease
    102999215
   05014 Amyotrophic lateral sclerosis
    102999215
   05016 Huntington disease
    102999215
   05017 Spinocerebellar ataxia
    102999215
   05020 Prion disease
    102999215
   05022 Pathways of neurodegeneration - multiple diseases
    102999215
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102999215
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102999215
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102999215
   05134 Legionellosis
    102999215
   05152 Tuberculosis
    102999215
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102999215
   05161 Hepatitis B
    102999215
   05160 Hepatitis C
    102999215
   05164 Influenza A
    102999215
   05162 Measles
    102999215
   05168 Herpes simplex virus 1 infection
    102999215
   05163 Human cytomegalovirus infection
    102999215
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999215
   05169 Epstein-Barr virus infection
    102999215
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102999215
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102999215
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 102999215
NCBI-ProteinID: XP_007190725
UniProt: A0A384ATK7
LinkDB
Position
Un
AA seq 105 aa
MCDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVRFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtgtgatgttgagaagggcaagaaaatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcataagactgggccaaatctccatggtctgtttgggcgaaag
acaggtcaggctgtcagattctcttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggagacgctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagaagggagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003361
Entry
103003361         CDS       T03086                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04932  Non-alcoholic fatty liver disease
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05134  Legionellosis
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05222  Small cell lung cancer
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103003361
   04215 Apoptosis - multiple species
    103003361
   04115 p53 signaling pathway
    103003361
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103003361
  09162 Cancer: specific types
   05210 Colorectal cancer
    103003361
   05222 Small cell lung cancer
    103003361
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103003361
   05012 Parkinson disease
    103003361
   05014 Amyotrophic lateral sclerosis
    103003361
   05016 Huntington disease
    103003361
   05017 Spinocerebellar ataxia
    103003361
   05020 Prion disease
    103003361
   05022 Pathways of neurodegeneration - multiple diseases
    103003361
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103003361
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103003361
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103003361
   05134 Legionellosis
    103003361
   05152 Tuberculosis
    103003361
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103003361
   05161 Hepatitis B
    103003361
   05160 Hepatitis C
    103003361
   05164 Influenza A
    103003361
   05162 Measles
    103003361
   05168 Herpes simplex virus 1 infection
    103003361
   05163 Human cytomegalovirus infection
    103003361
   05167 Kaposi sarcoma-associated herpesvirus infection
    103003361
   05169 Epstein-Barr virus infection
    103003361
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103003361
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103003361
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 103003361
NCBI-ProteinID: XP_007171564
UniProt: A0A383Z9I8
LinkDB
Position
Un
AA seq 105 aa
MCDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtgtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag
acaggtcaggctgtcggattctcttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggagacgctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagaagggagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004375
Entry
103004375         CDS       T03086                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04932  Non-alcoholic fatty liver disease
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05134  Legionellosis
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05222  Small cell lung cancer
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103004375
   04215 Apoptosis - multiple species
    103004375
   04115 p53 signaling pathway
    103004375
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004375
  09162 Cancer: specific types
   05210 Colorectal cancer
    103004375
   05222 Small cell lung cancer
    103004375
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103004375
   05012 Parkinson disease
    103004375
   05014 Amyotrophic lateral sclerosis
    103004375
   05016 Huntington disease
    103004375
   05017 Spinocerebellar ataxia
    103004375
   05020 Prion disease
    103004375
   05022 Pathways of neurodegeneration - multiple diseases
    103004375
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103004375
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103004375
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103004375
   05134 Legionellosis
    103004375
   05152 Tuberculosis
    103004375
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103004375
   05161 Hepatitis B
    103004375
   05160 Hepatitis C
    103004375
   05164 Influenza A
    103004375
   05162 Measles
    103004375
   05168 Herpes simplex virus 1 infection
    103004375
   05163 Human cytomegalovirus infection
    103004375
   05167 Kaposi sarcoma-associated herpesvirus infection
    103004375
   05169 Epstein-Barr virus infection
    103004375
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103004375
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103004375
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DDE_Tnp_1
Other DBs
NCBI-GeneID: 103004375
NCBI-ProteinID: XP_007192705
LinkDB
Position
Un
AA seq 87 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGSNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIK
NT seq 261 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggtcaaatctccatggcctgtttgggcgaaag
acaggtcaggctgtcggattctcttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017780
Entry
103017780         CDS       T03086                                 

Definition
(RefSeq) cytochrome c 2-like
  KO
K08738  cytochrome c
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04932  Non-alcoholic fatty liver disease
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05134  Legionellosis
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05222  Small cell lung cancer
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103017780
   04215 Apoptosis - multiple species
    103017780
   04115 p53 signaling pathway
    103017780
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017780
  09162 Cancer: specific types
   05210 Colorectal cancer
    103017780
   05222 Small cell lung cancer
    103017780
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103017780
   05012 Parkinson disease
    103017780
   05014 Amyotrophic lateral sclerosis
    103017780
   05016 Huntington disease
    103017780
   05017 Spinocerebellar ataxia
    103017780
   05020 Prion disease
    103017780
   05022 Pathways of neurodegeneration - multiple diseases
    103017780
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103017780
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103017780
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103017780
   05134 Legionellosis
    103017780
   05152 Tuberculosis
    103017780
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103017780
   05161 Hepatitis B
    103017780
   05160 Hepatitis C
    103017780
   05164 Influenza A
    103017780
   05162 Measles
    103017780
   05168 Herpes simplex virus 1 infection
    103017780
   05163 Human cytomegalovirus infection
    103017780
   05167 Kaposi sarcoma-associated herpesvirus infection
    103017780
   05169 Epstein-Barr virus infection
    103017780
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103017780
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103017780
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 103017780
NCBI-ProteinID: XP_007190472
UniProt: A0A384ASW4
LinkDB
Position
Un
AA seq 105 aa
MANAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW
GEETLMEYLENPKKYIPGTKMVFAGLKKKSEREDLIEYLKQATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atggcaaatgctgaggcaggcaagaagatctttgttcaaaaatgtgctcagtgccacaca
gtggaaaaaggtggaaaacacaagactggtccaaacctctggggcctttttggcagaaaa
acaggacaagcaccaggattttcttataccgatgcaaacaaaaacaaaggtgttatctgg
ggagaggagactctgatggaatatttggagaacccaaagaaatatatccctggaactaaa
atggtctttgctggtcttaaaaagaagagtgagagagaagatcttattgagtatttgaaa
caggcaacatcttcatga

DBGET integrated database retrieval system