KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999230
Entry
102999230         CDS       T03086                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01523  Antifolate resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04218  Cellular senescence
bacu04380  Osteoclast differentiation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04917  Prolactin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04926  Relaxin signaling pathway
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05030  Cocaine addiction
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05134  Legionellosis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05206  MicroRNAs in cancer
bacu05212  Pancreatic cancer
bacu05215  Prostate cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999230 (NFKB1)
   04014 Ras signaling pathway
    102999230 (NFKB1)
   04064 NF-kappa B signaling pathway
    102999230 (NFKB1)
   04668 TNF signaling pathway
    102999230 (NFKB1)
   04066 HIF-1 signaling pathway
    102999230 (NFKB1)
   04071 Sphingolipid signaling pathway
    102999230 (NFKB1)
   04024 cAMP signaling pathway
    102999230 (NFKB1)
   04151 PI3K-Akt signaling pathway
    102999230 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102999230 (NFKB1)
   04218 Cellular senescence
    102999230 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    102999230 (NFKB1)
   04620 Toll-like receptor signaling pathway
    102999230 (NFKB1)
   04621 NOD-like receptor signaling pathway
    102999230 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    102999230 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    102999230 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    102999230 (NFKB1)
   04660 T cell receptor signaling pathway
    102999230 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    102999230 (NFKB1)
   04659 Th17 cell differentiation
    102999230 (NFKB1)
   04657 IL-17 signaling pathway
    102999230 (NFKB1)
   04662 B cell receptor signaling pathway
    102999230 (NFKB1)
   04062 Chemokine signaling pathway
    102999230 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102999230 (NFKB1)
   04917 Prolactin signaling pathway
    102999230 (NFKB1)
   04926 Relaxin signaling pathway
    102999230 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102999230 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102999230 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    102999230 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999230 (NFKB1)
   05202 Transcriptional misregulation in cancer
    102999230 (NFKB1)
   05206 MicroRNAs in cancer
    102999230 (NFKB1)
   05203 Viral carcinogenesis
    102999230 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102999230 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102999230 (NFKB1)
   05221 Acute myeloid leukemia
    102999230 (NFKB1)
   05220 Chronic myeloid leukemia
    102999230 (NFKB1)
   05215 Prostate cancer
    102999230 (NFKB1)
   05222 Small cell lung cancer
    102999230 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102999230 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102999230 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102999230 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    102999230 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102999230 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102999230 (NFKB1)
   04931 Insulin resistance
    102999230 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102999230 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102999230 (NFKB1)
   05135 Yersinia infection
    102999230 (NFKB1)
   05133 Pertussis
    102999230 (NFKB1)
   05134 Legionellosis
    102999230 (NFKB1)
   05152 Tuberculosis
    102999230 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102999230 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    102999230 (NFKB1)
   05161 Hepatitis B
    102999230 (NFKB1)
   05160 Hepatitis C
    102999230 (NFKB1)
   05171 Coronavirus disease - COVID-19
    102999230 (NFKB1)
   05164 Influenza A
    102999230 (NFKB1)
   05162 Measles
    102999230 (NFKB1)
   05168 Herpes simplex virus 1 infection
    102999230 (NFKB1)
   05163 Human cytomegalovirus infection
    102999230 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999230 (NFKB1)
   05169 Epstein-Barr virus infection
    102999230 (NFKB1)
   05165 Human papillomavirus infection
    102999230 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102999230 (NFKB1)
   05145 Toxoplasmosis
    102999230 (NFKB1)
   05140 Leishmaniasis
    102999230 (NFKB1)
   05142 Chagas disease
    102999230 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102999230 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    102999230 (NFKB1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102999230 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank_5 Ank Ank_3 Death
Other DBs
NCBI-GeneID: 102999230
NCBI-ProteinID: XP_007172981
UniProt: A0A383ZD75
LinkDB
Position
Un
AA seq 974 aa
MYSSRMAEDDPYLGGHEQMFHLDPLNHTIFNPELFQPEMPLPTADGPYLQILEQPKQRGF
RFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVG
KHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTDACIRGYNPGLLVHPDL
AYLQAEGGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVV
SDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWE
GFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKD
KEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSSGGGGGAGSTGPGYGFPHYGFPTYG
GITFHPGTAKSNAGMKHGTIDTPSTNDPEGYDESDDREAINLCGQAAESTEQDKESCKRG
DEADPAYSVGVKEENRSSQDDLFLEKAMQLAKRHANALFDYAVTGDVKVLLAAQRHLTAV
QDESGDSVLHLAIIHLHAQLVRDLLEVTSGLISDEIINMRNDLYQTPLHLAVITKQEAVV
EDLLRAGADLSLLDRLGNSVLHLAAKEGHDTILSILLKHKKAAQLINHPNGEGLNAIHVA
MASNSLPCLLLLMAAGADVNAQERKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYD
GTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWDEDEGVPPGTTPLDMATS
WQVFDILNGKPYEPEFTSDDLLAQGDMKQLTEDAKLQLYKLLEIPDPDKNWATLAQKLGL
GILNNAFRLSPAPSKTLMDNYEVSGGTIKELVEALRQMGYTEAIEVIQAAFCTSGSAATS
PVETTSQAHSLPFSPASTGQQIDEFRDDSVCDSGVETSFRKLSFTESLTSGSSLLTINKV
PHDYGQEGPLEGKI
NT seq 2925 nt   +upstreamnt  +downstreamnt
atgtacagctccagaatggcagaagacgacccatatttgggagggcatgaacaaatgttt
catttggatcctttgaatcatacaatatttaatccagaattatttcaaccagagatgcca
ctgccaacagcagatggcccataccttcaaatattagagcaacctaaacagagaggattt
cgtttccgttatgtgtgtgaaggcccctcccatggaggactccctggtgcatctagcgaa
aagaacaagaagtcctatcctcaggtcaaaatctgcaactatgtgggacctgcaaaggtt
attgttcagttggtcacaaatggaaaaaacatccacctgcatgcgcacagcctggtggga
aaacactgtgaggacggcatctgcacggtaactgctggacccaaggacatggtggtcggc
tttgcaaacctgggtatacttcatgtgacaaagaaaaaagtatttgaaacactggaagca
cgaatgacagatgcatgtataaggggctataatcccggacttctggtgcatcctgatctt
gcctatttacaagcagaagggggaggagaccggcagctcacagatcgggaaaaggagatc
atccgccaggcagctcttcagcagacaaaggagatggacctcagcgtggtgcggcttatg
tttacagctttccttccagacagcaccggcagcttcacgaggcgcctggaacccgtggta
tcggacgccatctacgatagcaaagcccccaatgcctccaacttgaaaatagtaaggatg
gacaggacagctggatgcgtaactggaggggaagagatttatcttctctgtgacaaggtt
cagaaagatgacatccagattcgattttatgaggaggaggaaaatggtggaatctgggaa
ggattcggagatttttcccccacagatgttcatagacaatttgccatcgtcttcaaaact
ccaaagtataaagatatcaacattacaaaaccagcctctgtgttcgtccagcttcggagg
aaatctgatttggaaaccagtgaaccaaaaccttttctctactatcctgaaattaaagat
aaagaggaagtgcagaggaaacggcagaagcttatgcccaatttctcggatagtttcggt
ggcggcagtggggcgggagctggaggtggaggcatgttcggcagcagcggtggaggcggc
ggcgctggaagtaccggcccagggtatggcttcccgcactatggatttcctacatatggt
ggaattaccttccaccctggaaccgctaagtctaatgctgggatgaagcatggaaccata
gacaccccatctacaaatgaccctgaaggttatgacgagagtgatgacagagaggccata
aatctctgtgggcaggcagcagagagcaccgagcaagataaagagtcctgcaagcggggc
gatgaggctgatccggcgtactcggtaggagtgaaggaggagaatcgcagttcccaggat
gacctcttcctggagaaggctatgcagcttgccaagcggcacgccaatgccctgtttgac
tacgcggtgacaggagatgtgaaggtgctgctggctgcccagcgccatctcactgcggtg
caggacgagagcggggacagtgtcttacacttagcaatcatccaccttcatgctcagctt
gtgagagatctgctagaagtcacatctggcttgatttctgatgaaattatcaacatgaga
aatgatctctaccagacacccttgcacttggcagtgatcaccaagcaggaggctgtggtg
gaggacttgctgagggccggggccgacctgagccttctggaccgcttgggtaactctgtt
ttgcacctagctgccaaagaaggacacgatacaattctcagtattttactcaagcacaag
aaggcagcacaacttatcaaccaccccaacggggaaggtctgaacgccattcacgtggcc
atggcgagcaacagcttgccgtgtctgctgctgctcatggccgcgggggccgacgtcaac
gctcaggagcggaagtcggggcgcacggcgctgcacctggccgtggagcacgacaacatc
tccttggctggctgcctgctcctggagggtgatgcccatgtagacagcaccacctatgat
ggaactacacccctgcacatagcggctgggagagggtccacgaggctggcagctcttctc
aaggcagcaggagcagatcccctggtggagaactttgagcctctgtacgacctggatgac
tcttgggacgaggatgaaggggtcccgccaggaaccactcctctggatatggccaccagc
tggcaggtatttgacatattaaatgggaaaccctatgagccagagtttacatctgatgat
ttactggcacaaggagacatgaaacagctgactgaagatgcgaagttgcagctctacaag
ttgctagaaattcctgatccagacaaaaactgggctactctggcacagaaattaggtttg
gggatactaaataatgccttccggctgagtcctgctccttccaaaactctcatggacaac
tatgaggtctctggggggaccataaaggagctggtggaggccctgaggcagatgggctat
accgaagccattgaagtgatccaggcggccttctgcacgtcgggaagcgcggccaccagc
ccggtggagaccacctctcaggcccactcgctgcccttctcgcccgcctccacagggcag
caaatagacgagttccgggacgacagcgtctgtgacagcggcgtagagacatccttccgc
aagctcagcttcacagagtctctgaccagcggcagctcgttgctaactattaacaaagtg
ccccacgactacgggcaggaaggacctctagaaggcaaaatttag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019614
Entry
103019614         CDS       T03086                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01523  Antifolate resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04137  Mitophagy - animal
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04218  Cellular senescence
bacu04380  Osteoclast differentiation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04917  Prolactin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04926  Relaxin signaling pathway
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05030  Cocaine addiction
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05134  Legionellosis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05212  Pancreatic cancer
bacu05215  Prostate cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103019614 (RELA)
   04014 Ras signaling pathway
    103019614 (RELA)
   04064 NF-kappa B signaling pathway
    103019614 (RELA)
   04668 TNF signaling pathway
    103019614 (RELA)
   04066 HIF-1 signaling pathway
    103019614 (RELA)
   04071 Sphingolipid signaling pathway
    103019614 (RELA)
   04024 cAMP signaling pathway
    103019614 (RELA)
   04151 PI3K-Akt signaling pathway
    103019614 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103019614 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    103019614 (RELA)
   04218 Cellular senescence
    103019614 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    103019614 (RELA)
   04620 Toll-like receptor signaling pathway
    103019614 (RELA)
   04621 NOD-like receptor signaling pathway
    103019614 (RELA)
   04622 RIG-I-like receptor signaling pathway
    103019614 (RELA)
   04623 Cytosolic DNA-sensing pathway
    103019614 (RELA)
   04625 C-type lectin receptor signaling pathway
    103019614 (RELA)
   04660 T cell receptor signaling pathway
    103019614 (RELA)
   04658 Th1 and Th2 cell differentiation
    103019614 (RELA)
   04659 Th17 cell differentiation
    103019614 (RELA)
   04657 IL-17 signaling pathway
    103019614 (RELA)
   04662 B cell receptor signaling pathway
    103019614 (RELA)
   04062 Chemokine signaling pathway
    103019614 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103019614 (RELA)
   04917 Prolactin signaling pathway
    103019614 (RELA)
   04926 Relaxin signaling pathway
    103019614 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103019614 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103019614 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    103019614 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019614 (RELA)
   05202 Transcriptional misregulation in cancer
    103019614 (RELA)
   05203 Viral carcinogenesis
    103019614 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103019614 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103019614 (RELA)
   05221 Acute myeloid leukemia
    103019614 (RELA)
   05220 Chronic myeloid leukemia
    103019614 (RELA)
   05215 Prostate cancer
    103019614 (RELA)
   05222 Small cell lung cancer
    103019614 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103019614 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103019614 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    103019614 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    103019614 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103019614 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103019614 (RELA)
   04931 Insulin resistance
    103019614 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103019614 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103019614 (RELA)
   05135 Yersinia infection
    103019614 (RELA)
   05133 Pertussis
    103019614 (RELA)
   05134 Legionellosis
    103019614 (RELA)
   05152 Tuberculosis
    103019614 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103019614 (RELA)
   05170 Human immunodeficiency virus 1 infection
    103019614 (RELA)
   05161 Hepatitis B
    103019614 (RELA)
   05160 Hepatitis C
    103019614 (RELA)
   05171 Coronavirus disease - COVID-19
    103019614 (RELA)
   05164 Influenza A
    103019614 (RELA)
   05162 Measles
    103019614 (RELA)
   05168 Herpes simplex virus 1 infection
    103019614 (RELA)
   05163 Human cytomegalovirus infection
    103019614 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103019614 (RELA)
   05169 Epstein-Barr virus infection
    103019614 (RELA)
   05165 Human papillomavirus infection
    103019614 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103019614 (RELA)
   05145 Toxoplasmosis
    103019614 (RELA)
   05140 Leishmaniasis
    103019614 (RELA)
   05142 Chagas disease
    103019614 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103019614 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103019614 (RELA)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103019614 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103019614
NCBI-ProteinID: XP_007171011
UniProt: A0A383Z7L5
LinkDB
Position
Un
AA seq 562 aa
MWACADPCLPLLSDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGE
RSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRC
IHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPA
GRPLRLSPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFT
GPGWEARGSFSQAYLHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYL
PDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDHRPPTRRIAVPSRSSASVPKPAPQPY
PFTPSLSTINFEEFSPMVFPSGQIPSQTSALAPAPAPVLAQAPAPAPAMASALAQAPAPG
PVLAPGLAQAVTQPAPKTNPAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASV
DNSEFQQLLNQGVPMAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLS
GDEDFSSIADMDFSALLSQISS
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgtgggcttgtgctgacccttgtctccctctcctttcagacctcttccccctcatcttc
cccacggagccggcccaggcctccggtccctacgtggagatcatcgagcagcccaagcag
cggggcatgcgctttcgctacaagtgcgagggccgctcagcaggcagtatcccaggcgag
aggagcacagataccaccaagacccaccccaccatcaagatcaatggctacacggggcca
gggacagtccgcatctccctggtgaccaaggacccccctcaccggcctcacccccatgag
cttgtggggaaagactgccgggatggcttctatgaggctgagctctgcccggaccgctgc
atccacagcttccagaacctggggatccagtgtgtaaagaagcgggacctggagcaggcc
atcagtcagcgcatccagaccaacaacaaccccttccaagttcccatagaagagcagcgt
ggggactacgacctgaatgccgtccggctctgcttccaggtgacagtgcgggacccggca
ggcaggcccctacgcctgtcgcctgtcctctctcatcccatctttgacaaccgcgccccc
aacactgccgagctcaagatctgccgagtgaatcggaactctgggagctgccttgggggg
gatgagatcttcctgctgtgtgacaaggtgcagaaagaggatatcgaggtgtatttcacg
ggaccaggctgggaggcccgaggctctttttcacaagcctatttgcaccggcaagtggcc
attgtgttccggacgcccccctacgcggatcccggcctgcaggcccccgtgcgcgtctcc
atgcagctgcggcggccttccgatcgggagctcagcgagcccatggaattccagtacttg
ccagacacagatgatcgtcaccggattgaggagaaacgcaaaaggacatatgagaccttt
aagagcatcatgaaaaagagtcctttcaatggacccaccgaccaccgacctccgacccgg
cgcattgctgtgccttcccgcagctcagcttccgtccccaagccggctccccagccctat
ccctttacaccatctctcagcaccatcaactttgaggagttctcccccatggtctttcct
tctgggcagatcccaagccagacctcggccttggcaccggcccctgccccagtcctggcc
caggccccagcccctgccccagccatggcatcagccctggcccaggccccagcccctggc
ccagtcctagccccaggccttgctcaggctgtgacccaacctgcccccaagaccaaccca
gctggggaagggacactgacagaggccctgctgcagctgcagtttgatgctgatgaagac
ctgggggccctgcttggcaataacacagatccagccgtgttcacagacctggcatccgtc
gacaactctgagtttcagcagctgctgaaccagggtgtacccatggccccccatacagct
gagcccatgctgatggagtaccctgaggctataactcgtctggtgacagggtcccagagg
ccccctgacccagctcccactcccctgggagcctctggcctcaccaacggcctcctctca
ggggatgaagacttctcctccattgcggacatggacttctcagcccttctgagtcagatc
agctcctaa

DBGET integrated database retrieval system