KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999302
Entry
102999302         CDS       T03086                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04114  Oocyte meiosis
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04713  Circadian entrainment
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04728  Dopaminergic synapse
bacu04730  Long-term depression
bacu04742  Taste transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102999302 (ITPR3)
   04020 Calcium signaling pathway
    102999302 (ITPR3)
   04070 Phosphatidylinositol signaling system
    102999302 (ITPR3)
   04022 cGMP-PKG signaling pathway
    102999302 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102999302 (ITPR3)
   04210 Apoptosis
    102999302 (ITPR3)
   04218 Cellular senescence
    102999302 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102999302 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102999302 (ITPR3)
   04621 NOD-like receptor signaling pathway
    102999302 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    102999302 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    102999302 (ITPR3)
   04922 Glucagon signaling pathway
    102999302 (ITPR3)
   04929 GnRH secretion
    102999302 (ITPR3)
   04912 GnRH signaling pathway
    102999302 (ITPR3)
   04915 Estrogen signaling pathway
    102999302 (ITPR3)
   04921 Oxytocin signaling pathway
    102999302 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    102999302 (ITPR3)
   04918 Thyroid hormone synthesis
    102999302 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    102999302 (ITPR3)
   04924 Renin secretion
    102999302 (ITPR3)
   04925 Aldosterone synthesis and secretion
    102999302 (ITPR3)
   04927 Cortisol synthesis and secretion
    102999302 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102999302 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    102999302 (ITPR3)
   04971 Gastric acid secretion
    102999302 (ITPR3)
   04972 Pancreatic secretion
    102999302 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102999302 (ITPR3)
   04725 Cholinergic synapse
    102999302 (ITPR3)
   04728 Dopaminergic synapse
    102999302 (ITPR3)
   04726 Serotonergic synapse
    102999302 (ITPR3)
   04720 Long-term potentiation
    102999302 (ITPR3)
   04730 Long-term depression
    102999302 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    102999302 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    102999302 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    102999302 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102999302 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102999302 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102999302 (ITPR3)
   05012 Parkinson disease
    102999302 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    102999302 (ITPR3)
   05017 Spinocerebellar ataxia
    102999302 (ITPR3)
   05020 Prion disease
    102999302 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    102999302 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102999302 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102999302 (ITPR3)
   05163 Human cytomegalovirus infection
    102999302 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999302 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    102999302 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bacu04040]
    102999302 (ITPR3)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102999302 (ITPR3)
Ion channels [BR:bacu04040]
 Ligand-gated channels
  IP3 receptor
   102999302 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 102999302
NCBI-ProteinID: XP_007186941
UniProt: A0A384AHW3
LinkDB
Position
Un
AA seq 2667 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGTGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDVEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDVMVTKPNRERQKLMKEQNILKQIFGILKTPFRDKGCEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSLEYLSIEYSEEEVWLMWTDKNNEHHEKSIRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQAPPA
MLQVYEDPGGKNVRRSIQGVGHMMSTMVXSVFGPPSLPAGAGAPEPLDRSKFEENEDIVV
METKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDNGADGTAPAFDSATANMN
LDRIGEQAEAMFGVGRTSSMLEVDDEGGRMLLRVLIHLTMHDYAPLVSGALQLLFKHFSQ
RQEAMHTFEQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSSKGEEVEAGAA
KDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMDAHK
VMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNTGNQALLHKHLHLFLTPGLLEAETM
QHIFLNNYQLCSEIGEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTE
LTNAGDDVVVFYNDKASLAHLLDMMKTARDGVEDHSPLMYHISLVDLLAACAEGKNVYTE
IKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENF
TLDMARVCSKREKRLSDPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQLLQS
TTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSLLSSGASCAVAAQW
NVSNYKTAPRAFPRVTPTPNQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDVLHWP
ELLFLEGSEAHQRCESGGFLSKLIQHTKDLMESEEKLCVKVLRTLQQMLLKKTKYGDRGN
QLRKMLLQNYLQNRKSSSRGDLPDPMGTGLDQDWSAIAATQCRLDKEGATKLVCDLITST
KNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQETKSTV
AVNMSDLGSQPREGREPADPTAKGRVASFWMPSSSSRYSLGPSLRQGHEVSERVQSNEMG
TSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGL
LGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPLCKY
RMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERENSEV
SPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQMLKSSA
PAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQDEQ
GSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYP
YVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGPTLNI
LGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSIL
LFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPG
NHSRASPLGMPHGAATFVDTCSGDNMDCVSGVVVPEVLAEDEELDSTERACDTLLMCIVT
VMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLR
SEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYFIVLVRVKNKTDYT
GPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLTAQLN
ELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8004 nt   +upstreamnt  +downstreamnt
atgagcgagatgtccagcttcctccacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactctggggttggtggatgaccgctgtgtcgtggagccc
gcggctggggacctggacaaccctcccaagaagttccgagactgcctcttcaaggtgtgt
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagattgctgacgtggtgctgctgcagaagttacagcatgcggcccagatggag
cagaaacagaatgacacagagaacaagaaggtgcacggggacgtcgtgaagtacggcagt
gtgatccagctcctgcacatgaaaagtaacaagtacctgaccgtgaacaagcggctgccg
gccctgctggagaagaacgccatgagggtgacactggatgccacgggcaatgagggctcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaatgtggttgtgggg
gacaaggtgatcctgaaccctgtcaacgctgggcagcctctgcatgccagcaactatgag
ctcagcgacaatgccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgtttatgcagttccgagaccacctggaggaggtgttgaaagggggagacgtg
gtgcggctgttccacgcggagcaggagaagttcctgacgtgcgatgagtacaagggcaag
ctgcaggtgttcctgcgcaccacgctgcgccagtccgccacctcggccaccagctccaat
gccctctgggaggtggaggtggtccaccatgacccctgccgtggaggagctggccactgg
aacggcctgtaccgcttcaagcacctggccacgggcaactacctggctgctgaggagaac
cccagctacaagggtgacgcctctgatcccaaggcagcgggaacgggtgcccagggccgc
gcaggtcgccggaacgctggggagaagatcaaataccgcctggttgctgtgccccatggc
aacgacattgcttcccttttcgagctggatcccaccacgctgcagaaaaccgactccttt
gtgccccggaactcgtatgtccggctgcggcacctctgcaccaacacgtggatccagagc
accaacgtgcccattgatgtcgaagaggagcggcccatccggctcatgctgggcacgtgc
cccaccaaggaggacaaggaggccttcgccatcgtgtcggttcctgtgtccgagatccga
gacctggactttgccaatgacgccagctccatgctggccagcgccgtggagaaactcaac
gagggcttcatcagccagaatgaccgcagatttgttattcagctgctggaggacctggtg
ttcttcgtcagcgacgtccccaacaatgggcagaacgtgctggacgtcatggttaccaag
cccaaccgggagcggcagaagctgatgaaagagcagaacatcctcaaacagatctttggc
attctgaagaccccgttccgtgacaaggggtgtgagggccccctggtgcggctggaggag
ctgtcggaccagaagaacgccccctaccagcacatgtttcgcctgtgctaccgcgtgctg
cgccactcccaggaggactaccgcaagaaccaggagcacatcgccaagcagttcgggatg
atgcagtcccagattggctacgacatcctggccgaagacaccatcacggccctgctgcac
aacaaccgcaagctcctggagaagcacatcaccaagacggaggtggagaccttcgtcagc
ctggtgcggaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacatcgccatccccgtcacccaggagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccagaccgagcttcggcccgtgaaggagatggcgcagtccctc
gagtacctgagcatcgagtactcagaggaggaagtgtggctcatgtggaccgacaagaac
aatgagcaccacgagaagagcatcaggcagctggcccaggaggcccgggccggcaacgcc
cacgatgagaacgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ctggaccggcagtacctggccatcgatgagatctctcagcagctgggcgtcgacctgatc
ttcctgtgcatggcggatgagatgctgccctttgacctgcgtgcctccttctgccacctg
atgctgcatgtgcacgtggaccgtgacccccaggaactggtcacgcccgtcaagttcgcc
cgcctctggactgagatccccacggctatcaccatcaaggactatgattccaacctcaac
gcctcccgagatgacaagaagaacaagtttgctagcaccatggagttcgtggaggactac
ctcaacaacgtggtcagcgaggccgtgccctttgccaatgaggagaagaacaagctcacc
ttcgaggtggtcagcctggcgcacaacctcatctactttggcttctacagcttcagcgag
ctgctgcggctcacacgcactctgctgggcatcatcgactgcgtgcaggcccccccggcc
atgctgcaagtctatgaggacccaggcggcaagaacgtgcggcggtccatccagggagtg
gggcacatgatgtccaccatggtanngtctgtctttggcccccccagcctgcctgccggc
gccggtgcccctgagccgctggacagaagcaagtttgaggagaatgaggacattgtggtg
atggagaccaaactgaagatcctggaaatcttgcagttcatcctcaacgtccgcctggat
taccgcatctcatacctgctgtccgtcttcaagaaggagtttgtggaggtgtttcccatg
caggacaacggggctgatggcacagccccggccttcgactccgccaccgccaacatgaac
ctggaccgcatcggggagcaggcggaggccatgtttggagtggggaggacgagcagcatg
ctggaggtggacgacgagggtggccgcatgctcctgcgcgtgctcatccacctcaccatg
cacgactacgcgcccctggtctccggggccctgcagctgctcttcaagcacttcagccag
cgccaggaggccatgcacaccttcgagcaggtgcagctgctgatctcagcccaggacgtg
gagaactacaaggtgatcaaatcggagctggaccggctgcggaccatggtggagaagtcg
gagctgtgggtggacaagaagggcagcagcaagggcgaggaggtggaggcaggcgccgcc
aaagacaagaaggagcggcccacggacgaggagggctttctgcacccgcctggggagaag
agcagtgagaactaccagatcgtcaagggcatcctggagcggctgaacaagatgtgtggc
gtcggggagcagatgaggaagaaacagcagcggctgctcaagaacatggatgcccacaag
gtcatgctggacctgctgcagatcccctatgacaagggtgatgccaagatgatggagatc
ctgcgctacacacaccagttcctgcagaagttctgtgctgggaacaccggcaaccaggcc
ctgctgcacaagcacctgcacctcttcctcacgccagggctgctggaggcggagaccatg
cagcacatcttcctgaacaactatcagctgtgctccgagatcggcgagcccgtgttgcag
cacttcgtgcacctgctggccacccacgggcgccatgtgcagtacctggacttcctgcac
accgtcatcaaggccgagggcaagtacgtcaagaagtgccaggacatgatcatgaccgag
ctgaccaacgcaggtgacgacgtggtcgtgttctacaacgacaaggcctcgctggcccac
ctgctggacatgatgaagactgcccgggacggcgtggaggaccacagccccctcatgtac
cacatttccctggtggacctgctggccgcctgcgccgagggcaagaacgtgtacaccgag
atcaagtgcacgtccctgctgcccctggaggatgtggtgtctgtggtgacgcacgaggac
tgcatcaccgaggtgaaaatggcctacgtgaactttgtgaaccactgctacgtggacacg
gaggtggagatgaaggagatctataccagcaaccacatctggacactctttgagaacttc
accctggacatggctcgggtctgcagtaagcgtgagaagcgcctgtctgaccccaccctg
gagaagtatgtgctgaccgtcgtcctagacaccatcaacgccttcttcagctccccgttc
tctgagaacagcacctccctgcagacacaccagacgatcgtggtgcagctgctgcagtcc
accacacggctgcttgagtgtccgtggctgcagcagcagcacaagggttccgtggaggcc
tgcatccggaccctcgccatggtggccaagggccgggccatctcgctgcccatggacctg
gatgcccacatcagctcactgctcagcagtggtgccagctgtgcagttgccgcccagtgg
aacgtctccaactacaagacggccccgcgcgccttcccccgcgtcacgcccacccccaac
cagtgggactacaagaacatcattgagaagctgcaggacatcatcacggccctggaggag
cggttgaagcccctagtgcaggccgagctgtccgtactggtggacgtcctgcactggccc
gagttgctcttcctggagggcagtgaggcccaccagcgctgtgagagtggaggcttcctg
tccaagctgatccagcacaccaaggacctcatggagtcggaggagaagctgtgcgtcaag
gtgctgaggacgctgcagcaaatgctgcttaagaagaccaagtacggggaccggggcaac
cagctgcgcaaaatgctgctgcaaaactacctccagaaccggaagtccagctcgcggggg
gaccttccagaccccatgggcaccggcctggatcaagactggtcagcgatcgcagccacc
cagtgccggctggacaaggagggggccaccaagctggtgtgtgacctcatcaccagcacc
aagaacgagaagatcttccaggagagcattggcctggccatccgcctgctggatggtggc
aataccgagatccagaaatccttctacaacctgatgacgagcgacaagaagtcagagcgc
ttcttcaaggtcctgcacgaccgcatgaagcgggcccagcaggagaccaagtccacggtg
gccgtcaacatgagcgacctgggcagccagccgcgcgagggccgggagccagcagacccc
actgcgaaaggccgcgtggcctccttctggatgcccagctcctcatcccgctattcgctg
ggccccagcctgcgccaggggcacgaggtgagcgagcgcgtgcagagcaacgagatgggc
acgtccgtgctcatcatgcagcccatcctgcgctttctgcagctgctgtgcgagaaccac
aaccgggacctgcagaacttcctgcgctgccagaacaacaagaccaactacaacctggtg
tgcgagactctgcagttcctggacatcatgtgcggcagcaccacgggcggtcttgggctg
ctggggctctacatcaacgaggacaacgtgggccttgtcatccagaccctggagaccctc
accgagtattgccagggcccctgccacgagaaccagacctgcatcgtgacgcacgagtcc
aatggcatagacatcatcaccgcgctgattctcaatgacatcagtcccctgtgcaagtac
cgtatggacctggtgctgcaactcaaggacaacgcctccaagctgctcctggctctgatg
gagagccggcacgacagtgaaaacgccgagcgcatcctcatcagcctgcggccccaggag
ctggtggacgtcatcaagaaggcctacctgcaggaggaggagcgtgagaactcggaagtg
agcccacgtgaagtgggccacaacatctacatcctggcgctgcagctctccaggcacaac
aagcagctgcaacacctgctgaagcccgtgaagcgcatccaagaggaggaggccgagggc
atctcttctatgctcagcctcaacaacaagcagctgtcacagatgctcaagtcctcagca
ccggcacaggaggaggaggaggaccccctggcctactatgagaaccacacgtctcagata
gagatcgtgcggcaggaccgcagcatggagcagatcgtgttcccggtgcccggcatctgc
cagttcctgacggaggagaccaagcaccggctcttcaccaccaccgagcaggacgagcag
ggtagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaacgagatggagtgg
cagcgcaagctccgcagcatgccactcatctactggttctcccgccgcatgaccctgtgg
ggcagcatctccttcaacctggcggtttttatcaacatcatcatcgccttcttctacccc
tacgtggagggtgcatccacaggtgtgctgggctcccccctcatctcgctgctgttttgg
atcctcatctgcttctccatcgcggccctgttcaccaagcgctatagcatccgtcccctc
atcgtggcgctcatcctgcgctccatctactacctgggcattgggcccacgctcaacatc
ctgggtgccctcaacctgaccaacaagatcgtgttcgtggtgagcttcgtgggcaaccgt
ggcaccttcatccggggctataaggccatggtcatggacatggagttcctgtaccacgtc
ggctacatcctgacgagtgtcctgggcctctttgcccatgagcttttctacagcatcctg
ctctttgacctcatctaccgcgaagagacactgttcaatgtcatcaagagtgtgacccgc
aacggccgctccatcctgctcaccgccctactggccctcatcctggtctacctcttctcc
attgttggcttcctcttcctcaaggatgacttcattctcgaggtcgaccggctgcccggc
aaccactccagagccagccccctggggatgccacatggagctgccacatttgtggacaca
tgcagtggggacaacatggactgtgtctcaggggtcgtggtgcccgaggtcctggcagag
gatgaggagctggacagcacggagcgggcctgtgacaccctgctcatgtgcatcgtcacc
gtcatgaaccacgggctgcgcaatggtggtggtgtgggtgacattctccgcaagccctcc
aaggacgagtctctcttcccggcccgcgtggtctatgacctcctgttcttcttcattgtc
atcatcatcgtgctgaacctcatctttggggtgattatcgacacctttgccgacttgcgc
agtgagaagcagaagaaggaagaaattctcaagaccacgtgcttcatctgtggtctggag
agggacaagtttgacaacaagacggtgtcatttgaggagcacatcaagttcgagcacaac
atgtggaactacctgtacttcattgtgctggtccgtgtgaagaacaagacggactacaca
gggcccgagagctacgtggcccagatgatcaagaacaagaacctggactggttcccccgg
atgcgggccatgtcactggtgagcaacgagggggagggggagcagaacgagatccggatt
cttcaggacaagctcaactccaccatgaagctggtgtcccacctcactgcccagctcaac
gagctcaaggagcagatgacggagcagcggaaacgcaggcaacgcctgggcttcgtggat
gtccagaactgcatgagccgctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010644
Entry
103010644         CDS       T03086                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04114  Oocyte meiosis
bacu04140  Autophagy - animal
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04713  Circadian entrainment
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04728  Dopaminergic synapse
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103010644 (ITPR1)
   04020 Calcium signaling pathway
    103010644 (ITPR1)
   04070 Phosphatidylinositol signaling system
    103010644 (ITPR1)
   04022 cGMP-PKG signaling pathway
    103010644 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103010644 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103010644 (ITPR1)
   04210 Apoptosis
    103010644 (ITPR1)
   04218 Cellular senescence
    103010644 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103010644 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103010644 (ITPR1)
   04621 NOD-like receptor signaling pathway
    103010644 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    103010644 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103010644 (ITPR1)
   04929 GnRH secretion
    103010644 (ITPR1)
   04912 GnRH signaling pathway
    103010644 (ITPR1)
   04915 Estrogen signaling pathway
    103010644 (ITPR1)
   04921 Oxytocin signaling pathway
    103010644 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    103010644 (ITPR1)
   04918 Thyroid hormone synthesis
    103010644 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    103010644 (ITPR1)
   04924 Renin secretion
    103010644 (ITPR1)
   04925 Aldosterone synthesis and secretion
    103010644 (ITPR1)
   04927 Cortisol synthesis and secretion
    103010644 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103010644 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    103010644 (ITPR1)
   04971 Gastric acid secretion
    103010644 (ITPR1)
   04972 Pancreatic secretion
    103010644 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103010644 (ITPR1)
   04725 Cholinergic synapse
    103010644 (ITPR1)
   04728 Dopaminergic synapse
    103010644 (ITPR1)
   04726 Serotonergic synapse
    103010644 (ITPR1)
   04720 Long-term potentiation
    103010644 (ITPR1)
   04730 Long-term depression
    103010644 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    103010644 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103010644 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103010644 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103010644 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103010644 (ITPR1)
   05012 Parkinson disease
    103010644 (ITPR1)
   05016 Huntington disease
    103010644 (ITPR1)
   05017 Spinocerebellar ataxia
    103010644 (ITPR1)
   05020 Prion disease
    103010644 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    103010644 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103010644 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103010644 (ITPR1)
   05163 Human cytomegalovirus infection
    103010644 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103010644 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103010644 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bacu04040]
    103010644 (ITPR1)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103010644 (ITPR1)
Ion channels [BR:bacu04040]
 Ligand-gated channels
  IP3 receptor
   103010644 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans Plk4_PB2
Other DBs
NCBI-GeneID: 103010644
NCBI-ProteinID: XP_007192543
UniProt: A0A384AZ14
LinkDB
Position
Un
AA seq 2749 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVMLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSLDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDGNKEVRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPTAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEG
PSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EAMDGASGENEHKKTEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILERYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTAMNWRLTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKLISIDELDNAELPQAPDSENSTEQELELSPPLRQLEDHKRGEALRQILV
NRYYGNVRPSGRRESLTSFGNGPLSPGGPGKPGGGGGGSGSSSMSRGEMSLAEVQCHLDK
EGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFY
DRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPMTQITEEVRDQLLEASA
ATRKAFTTFRREADPDDHYQSGEGAQATADKTKDDLEMSAVITIMQPILRFLQLLCENHN
RDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLT
EYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIME
SRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAH
QLARHNKELQTMLKPGGQVEGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTK
ESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISF
NLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTI
LRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLLI
CAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYL
FFKDDFILEVDRLPNETALPEASESLASEFLYSDVCRVETGENCSSPAPKEERVPAEETE
QDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIV
LNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHY
LCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEK
LESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8250 nt   +upstreamnt  +downstreamnt
atgtctgacaagatgtctagtttccttcatatcggagacatttgttctctgtacgccgag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaagctggggaccttaacaatccacccaagaaattcagagattgcctctttaaacta
tgtcccatgaatcgctactctgcccagaagcagttctggaaagctgctaagccaggagcc
aacagcacgacagacgcagtattgcttaacaaactacaccatgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtgatccagtatggcaatgtg
atccagctcttgcatttgaaaagtaataaatacctaacagtgaataagaggcttccagct
ctgctggagaagaatgccatgagagtaatgttggacgaggctggcaacgaagggtcctgg
ttttacattcagccgttctacaagctgcgatccatcggagacagtgtggtcataggtgac
aaggttgttctgaaccccgtgaatgctggccagcccttacatgccagcagtcatcagctg
gtggataacccaggctgcaacgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagatgacatattaaaggggggtgacgtcgtg
aggctgttccacgccgagcaggagaagttcctcacctgtgacgagcacaggaagaagcag
cacgtcttcctgagaactaccggccggcagtcagccacgtccgccactagctccaaagcc
ctgtgggaggtggaggtggtccagcatgacccgtgtcggggtggagcagggtattggaac
agcctcttccgtttcaagcatcttgctacagggcattacttagcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcactggaccctgatcaggatgcctcc
cgaagcaggttgcgaaacgcccaagagaagatggtgtactccctggtctctgtgcccgaa
ggcaatgacatctcgtccatctttgagctagatcccaccaccctccgtggaggcgatagc
cttgtcccgagaaactcctatgtccggctcagacacctgtgtactaatacctgggttcac
agcacaaatatccccattgacaaggaagaagaaaaacccgtgatgctaaaaattggaacc
tctcccgtgaaggaggacaaagaagcatttgccatagttccggtctctcctgctgaggtt
cgggacctggactttgccaatgatgccagcaaggtgctgggttccatagctgggaagctg
gagaagggcaccatcacccagaatgagagaagatctgtaaccaagctgctggaagacttg
gtttactttgtcactggtggaactaactccggtcaagatgttcttgaagtggtcttctct
aagcccaacagagaacggcagaagctgatgagagaacagaatatcctcaagcagatcttc
aagttgttacaggccccattcacagactgcggtgacggcccgatgctacgtctggaggag
ctgggggaccagcggcacgcacccttcagacacatctgccgcctctgctacagggtcctg
agacactcccagcaggactacagaaagaaccaggagtacatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgctggctgaagacaccatcactgccctgctccac
aataatcggaaactcctggaaaaacacatcaccgcggcggagattgacaccttcgtcagt
ctggtgcgaaagaacagggagcccagattcttagattacctctctgatctctgcgtgtcc
atgaacaaatccattccggtgacccaggaactgatatgtaaagctgtgctgaatccaacc
aacgctgacattctgattgagaccaagttggtgctctctcgtttcgaatttgaaggtgtt
tctactggagagaacgctctggaggcaggagaggatgaggaagaggtgtggctgttttgg
agggacggcaacaaagaggttcgcagtaagagtgtgagggagctggcgcaggatgctaag
gagggtcagaaagaagaccgggacgtcctcagctactacaggtaccagctgaacctcttt
gcgaggatgtgcctggaccgccagtacctcgccatcaacgaaatctcgggccagctggac
gtggatctcattctccgctgcatgtctgatgagaacctgccctatgacctgcgggcgtcc
ttctgccgtctcatgctccacatgcatgtggaccgagacccacaggagcaagtcactccc
gtgaaatacgcccgcctctggtccgagattccctccgagatcgccattgatgactatgat
agtagtggcacttccaaagatgaaattaaggagaggtttgctcagactatggaatttgtg
gaggagtatttaagagatgtggtgtgtcagaggttccctttctctgataaggagaaaaat
aaacttacatttgaggttgtaaacttagctaggaatctcatatactttggtttctacaac
ttctctgaccttctacgattaaccaaaatcctcctggccatattggactgtgtgcacgtg
accacaatcttccccatcagcaagatggcgaagggagaggagaataaaggtagtaacgtg
atgcggtccatccatggggttggagagctgatgacccaggtggtgctccggggaggaggc
ttcctgcccatgactcccacggccgccgcccctgagggcaacgtgaagcaagcagagccg
gagaaggaggacatcatggtgatggacaccaagttgaagatcattgaaatactccagttt
attttgaatgtgaggttggattataggatctcctgcctcctgtgtatatttaagcgggag
tttgatgaaagcaattcccagacttcggaaacatcctccggaaacagcagccaagaggga
ccaagtaatgtaccaggtgctcttgactttgaacacattgaggagcaagccgagggcatc
ttcggaggaagtgaggagaacacgccactggacctggacgaccacggcggcagaaccttc
ctccgggtcctgctccatttgacaatgcacgactacccacccctggtgtcaggggccctg
cagctcctctttcggcacttcagtcagaggcaggaggtcctgcaggccttcaaacaggtt
caactgcttgttaccagccaagatgtcgacaactacaaacagatcaaacaagacttggac
caactgagatccatcgtggagaagtcagagctttgggtgtacaaagggcagggccccgac
gaggccatggacggtgcatctggtgaaaatgaacataagaaaacagaggaggggaataac
aagtcacagaagcatgaaagcaccagcagctataactacagggtggtcaaagagattttg
attcgactcagcaaactctgtgtccaagagagcgcgtcggtgcggaagagcaggaagcag
cagcagcgcctgctccggaacatgggcgcccacgccgtggtgctggagctgctacagatc
ccctacgagaaggccgaagacaccaagatgcaggagataatgaggctggctcacgagttt
ctgcagaatttctgtgctggcaaccagcagaatcaggctttgctccacaaacacataaac
ctgtttctcaacccagggatcctggaggcggtcacgatgcagcacatcttcatgaacaat
ttccagctgtgtagtgagatcaacgagagagtcgtccagcactttgttcactgcattgag
actcacggtcgaaacgtccagtacatcaagttcttgcagacgattgtcaaggccgaaggg
aaattcatcaaaaagtgccaagacatggtcatggctgagctggttaattcaggagaggat
gtcctcgtattctacaacgacagagcctctttccagactctgatccagatgatgaggtcg
gaacgggaccggatggatgagaacagccctctcatgtaccacatccacctggtcgagcta
ttggccgtgtgcacagagggcaagaacgtctacacggagatcaagtgcaactccctgctc
ccactggatgacattgtccgcgtggtgacccacgaggactgcatccccgaggttaaaatt
gcatacattaacttcctgaatcactgctatgtggatacggaggtggaaatgaaggagatt
tataccagtaatcacatgtggaaattgtttgagaatttccttgtggacatctgcagggcc
tgtaacaacacaagtgacaggaaacacgcagactcaattttggagaggtatgtcaccgaa
attgtcatgagcatcgttactacgttcttcagttctcccttctcagaccagagtacgact
ttgcagactcgccagcccgtctttgtgcagctgctacaaggtgtgttcagggtttaccac
tgcaactggctcatgccgagccagaaggcctcggtggagagctgcattcgggtgctctct
gatgtagccaagagccgggccattgccatccccgtggacctggacagccaggtcaacaac
ctcttcctcaagtcccacaacatcgtgcagaaaactgccatgaactggcggctgacggcc
cgcaatgcagctcgcagagactctgtcctggcagcttccagagactaccggaatatcatc
gagcgcttgcaggacatcgtctctgccctggaggaccgcctcaggcccctggtgcaggcc
gagttatctgtgctggtggacgtcctccacaggcctgagctgcttttcccggagaacaca
gatgccagaagaaagtgtgaaagtggtggcttcatttgcaagttaataaagcacactaaa
cagctgctagaggagaatgaggagaaactctgcattaaggtcctacagaccctcagagaa
atgatgaccaaagatagaggctatggagaaaagctgatttccattgatgaattggataat
gcagagctgccccaagctccggattctgagaactccaccgagcaggagcttgaactgagt
ccacccctgaggcaactggaggaccataaaaggggtgaggccctcaggcagattttggtc
aaccgttactatggaaacgtcagaccttcaggaagaagagagagcctgaccagctttggc
aatggcccgctgtcaccaggaggacccggcaagcccgggggaggagggggaggttccggg
tccagctccatgagcaggggggagatgagcctggccgaggttcagtgccaccttgacaag
gagggggcctccaatctggtcatcgacctcataatgaacgcatccagcgatcgagtgttc
catgaaagcattctcctggccatcgccctgctggaaggaggcaacaccaccatacagcac
tcctttttctgccggttgacagaagataagaagtcggagaaattcttcaaggtcttctat
gaccgaatgaaggtggcccagcaagaaatcaaggcaacggtgacagtgaacaccagtgac
ttgggaaataaaaagaaagatgatgaggtagacagggacgccccatcacggaaaaaagcc
aaagagcccatgacacagataacggaagaggtccgggatcagctcctggaggcctctgcc
gccaccaggaaagccttcaccaccttcagaagggaggctgaccccgacgatcactaccag
tcaggggagggcgcccaggccacagcagacaagaccaaggacgacctggagatgagcgcg
gtcatcaccatcatgcagcccatcctccgcttcctgcagctcctgtgcgaaaaccacaac
cgggacctccagaacttccttcgttgccaaaataacaagaccaactacaatttggtatgt
gagacactgcagtttctggactgtatttgtggaagtaccacggggggtcttggtcttctc
gggctctatatcaacgaaaagaatgtggcccttatcaaccaaaccctggaaagtctgacc
gaatactgtcaaggaccttgccatgagaaccagaactgcatagccacccatgaatccaat
ggcattgacatcatcacagcgctcatcctcaatgacatcaaccctctgggaaagaagagg
atggaccttgtattagaactgaagaacaacgcatccaagttgctcctggccatcatggag
agcaggcacgacagtgaaaatgccgagaggatactctataacatgaggcccaaggaactg
gtggaagtgatcaagaaagcctacatgcaaggcgaagtggaattcgaggatggagagaat
ggcgaggacggagctgcttcccccaggaacgtgggacacaacatctacatcttagctcat
cagttggctcggcacaacaaagaacttcagaccatgctgaaacctggtggccaagtggag
ggagacgaagctctggagttttacgccaagcacacggcccagatagagattgtcaggtta
gaccgaaccatggaacagattgttttccccgtgcccagtatatgtgaattcctcaccaag
gagtcaaagctccgaatatactacactacagagagggatgagcaaggcagcaagatcaac
gatttcttcctgcggtccgaggacctcttcaatgagatgaattggcaaaagaagctgcga
gcccagcccgttctgtactggtgtgcccgcaacatgtctttctggagcagcatttcattc
aacctggctgtcctgatgaatctgcttgtggcatttttctacccatttaaaggagtccga
ggaggaaccctggaaccacactggtcagggctgctgtggacagccatgctcatatctctg
gccattgtcattgccctccccaagccccacggcatccgggccttaatcgcttccacaatt
ctccggttgatattttcggtcgggttacaacccacgttgtttcttctgggagctttcaac
gtctgcaataaaatcatctttctgatgagctttgtgggcaactgtggaacattcaccaga
ggctaccgagccatggttctggatgttgagttcctttatcatttgctgtatctgctgatc
tgcgccatggggctcttcgtccatgaattcttctacagtttgctgctttttgacttagtg
tacagagaagagactctgcttaatgtcattaaaagcgtcactcgcaacggacggtccatc
atcttgacggcggtcctggctttgatcctggtttacctgttctcaatagtgggctacctt
ttcttcaaggatgacttcatcttggaagtagataggctgcccaatgaaaccgcgcttcca
gaagccagtgagagtttggcaagcgagttcctgtactctgacgtgtgtagggtggagact
ggggagaactgctcctctccggcacccaaagaagagcgggtccctgcagaggagacggag
caggataaagagcacacgtgcgagacgctcctgatgtgcatcgtcacggtgctgagtcac
gggctgcggagcgggggcggagtgggagatgtgctcaggaagccgtccaaagaggagccc
ctctttgctgcccgagtgatctatgacctcttgttcttcttcatggtcatcatcattgtc
cttaatctgattttcggggtcatcattgacacctttgccgatctgaggagtgaaaagcag
aagaaagaggagatcttaaagaccacgtgctttatctgcggcttggaaagagacaagttt
gacaacaagaccgtcacctttgaagagcacatcaaggaggagcacaacatgtggcactac
ctgtgcttcatcgtcctggtgaaagtcaaggactccacggagtacacggggcccgagagc
tacgtggcggaaatgatcaaggaaagaaaccttgactggttcccaaggatgagagccatg
tccctggtcagcagcgattcggaaggagaacagaatgagctgaggaacctgcaggagaag
ctggagtccaccatgaagctggtcactaatctttctgggcagctgtcagaattaaaggac
cagatgacagaacaaaggaagcagaaacaaagaattggtcttctagggcatcctcctcac
atgaacgtcaacccacagcaaccagcataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018280
Entry
103018280         CDS       T03086                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04114  Oocyte meiosis
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04728  Dopaminergic synapse
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103018280 (ITPR2)
   04020 Calcium signaling pathway
    103018280 (ITPR2)
   04070 Phosphatidylinositol signaling system
    103018280 (ITPR2)
   04022 cGMP-PKG signaling pathway
    103018280 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103018280 (ITPR2)
   04210 Apoptosis
    103018280 (ITPR2)
   04218 Cellular senescence
    103018280 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103018280 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103018280 (ITPR2)
   04621 NOD-like receptor signaling pathway
    103018280 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    103018280 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103018280 (ITPR2)
   04929 GnRH secretion
    103018280 (ITPR2)
   04912 GnRH signaling pathway
    103018280 (ITPR2)
   04915 Estrogen signaling pathway
    103018280 (ITPR2)
   04921 Oxytocin signaling pathway
    103018280 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    103018280 (ITPR2)
   04918 Thyroid hormone synthesis
    103018280 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    103018280 (ITPR2)
   04924 Renin secretion
    103018280 (ITPR2)
   04925 Aldosterone synthesis and secretion
    103018280 (ITPR2)
   04927 Cortisol synthesis and secretion
    103018280 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103018280 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    103018280 (ITPR2)
   04971 Gastric acid secretion
    103018280 (ITPR2)
   04972 Pancreatic secretion
    103018280 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103018280 (ITPR2)
   04725 Cholinergic synapse
    103018280 (ITPR2)
   04728 Dopaminergic synapse
    103018280 (ITPR2)
   04726 Serotonergic synapse
    103018280 (ITPR2)
   04720 Long-term potentiation
    103018280 (ITPR2)
   04730 Long-term depression
    103018280 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    103018280 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103018280 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103018280 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103018280 (ITPR2)
   05012 Parkinson disease
    103018280 (ITPR2)
   05017 Spinocerebellar ataxia
    103018280 (ITPR2)
   05020 Prion disease
    103018280 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    103018280 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103018280 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103018280 (ITPR2)
   05163 Human cytomegalovirus infection
    103018280 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103018280 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bacu04040]
    103018280 (ITPR2)
Ion channels [BR:bacu04040]
 Ligand-gated channels
  IP3 receptor
   103018280 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 103018280
NCBI-ProteinID: XP_007194929
UniProt: A0A384B6N2
LinkDB
Position
Un
AA seq 2701 aa
MSDKMSSFLYIGDIVSLYAEGSVNGFINTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGETVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGDLPTPKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQDVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKLVSMQGDNPMESAILSDDIDEEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCMSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGELMTQMVLSRGSIFPVSVPDIQPSLHPSKLGSPAE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENNGNAETSTNGSADTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSSYENGE
MGENQVKGGEEPIEDSNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVIQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDGQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPSWDYRNIIEKLQDVVASLEQQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGTTLRKILLNRYFRGDYGICMNGHLSGAYCKSAQGGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSSLHLK
DGMKGQLTEASSATSKAYCAYRREMDPEIDIMCTGSEAGNAEEKSAEEVTVSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVVLVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVVKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDDGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRSNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFF
FSKPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPLTGSNAVSAMTFASILGTCEKENCSPT
IPASNTAAEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt   +upstreamnt  +downstreamnt
atgtccgataaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcaacacgctggggctagtggatgacagatgtgtggtgcac
ccagaggcgggggacctcgccaaccctcccaagaagttccgagactgcctctttaaggtg
tgccctatgaaccgatattctgctcagaaacaatactggaaagccaagcaagctaaacaa
gggaaccacacagaggcagccttgctgaagaaattacagcatgctgcagaactggaacaa
aaacaaaatgaatcagagaataagaagctgttgggagaaactgtgaaatatagtaatgtt
atacaactactgcatataaaaagcaacaagtatctgactgtcaacaagagattacccgct
ttactggagaagaatgccatgcgtgtgtccttggatgctgcaggaaatgaagggtcttgg
ttttatattcatcccttctggaagctgagaagcgagggtgacaatatcgttgttggagat
aaagttgttttgatgcccgtgaatgcaggacagccactacatgccagcaacatagagctt
cttgataatccagggtgtaaagaggtgaatgctgttaattgcaacactagctggaaaatc
actttattcatgaaatatagttcctatcgagaggatgtactaaaagggggtgatgttgtt
cgattgtttcatgcggaacaagagaagtttctgacttgtgatgaatatgagaaaaaacag
cacattttccttcgtacaactttgcgtcaatcagccacttctgctaccagttctaaagca
ctctgggaaatagaggtagttcatcatgacccatgccgtggaggtgcaggacaatggaac
agcttgttcaggtttaaacatcttgcaaccgggaactatttagctgcggagcttaaccct
gattatcgagatgcccaaaatgaaggaaaaaatgtgagagatggagatcttccaactcca
aagaagaaacgccaggcaggggagaagatcatgtacactttggtctcagtcccacatgga
aatgacattgcatccctttttgaactggatgccacaactcttcagagagcggactgcctg
gtcccaaggaattcatacgttcggttaagacatttatgtacaaacacgtgggtaaccagt
actagcatccccatagacacagatgaagagaggcctgttatgttgaagattggaacttgc
caaacaaaagaagataaagaagcttttgccattgtgtctgtcccgctgtctgaggtccga
gacttagacttcgccaatgacgcaaataaagtgctggcgaccacagttaaaaagctggaa
aacggcacaataactcagaatgaaaggaggtttgtgaccaaattattggaagaccttatc
ttctttgttgctgatgtacctaacaatggacaagacgttctggatgtggtaatcaccaag
ccaaaccgagaacgtcagaaattaatgagggaacaaaacatattggcacaggtatttggg
attctgaaagcaccctttaaggagaaagcaggagaaggctcaatgctgagacttgaagat
ctgggggatcaaagatacgccccctacaagtacatgctgaggctgtgctaccgtgtgctg
agacattcacagcaggactaccggaaaaatcaggaatatattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagataccatcacagctttgttgcac
aacaacagaaaactactagagaaacacatcacagcaaaagaaatagaaacatttgttagt
ttactcaggagaaatcgggagccaaggtttttggattatttatcagatctctgtgtgtct
aacaccaccgctatacctgtaactcaagaactcatctgcaaatttatgttgagcccaggc
aatgcagatattctcattcaaactaagctggtctcaatgcaaggagacaaccccatggag
agcgccatcctttcagatgacattgatgaggaagaagtttggctctactggattgatagc
aacaaggaacctcatggcaaagctatcagacaccttgctcaggaagcaaaagaaggcacc
aaggctgatttagaagttcttacctactacaggtaccagctaaatctctttgcaaggatg
tgtttggatcgccagtatctggccataaaccagatttctacgcagctctctgttgatttg
atcctgcggtgtatgtcggatgagagcctgccctttgacctccgagcatctttttgtcgc
cttatgctgcacatgcatgttgaccgggatccccaggagtctgtggtgcctgttcgctat
gccaggctctggacagaaatccccacgaagatcacgattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgcactgacaatggaatttgttgaagaa
tacttgaaagaggttgtaaatcagccttttccttttggagataaagaaaaaaacaaactg
acatttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagt
gagttactaaggctaacaagaacacttctggctatcctcgatattgttcaggcccccatg
tcatcatattttgaaagattaagcaaatttcaagatggaggaaacaatgtcatgagaacc
atccatggggtgggggaactgatgacccagatggtgctcagcagaggttccatcttcccc
gtgagtgtgcctgacatccagcccagcctgcatcccagcaagctggggagccccgccgag
cacgaggatgtcactgtcatggacaccaagctgaagattattgagattttacagtttatc
ctgagtgtcagactggattataggatctcatatatgctgtcaatatataagaaggaattt
ggggagaacaatggaaatgctgaaacgtccaccaatggctctgccgatacattgctgcca
tcagctattgttcctgacatagatgaaattgcagctcaggcagaaactatgtttgctgga
agaaaggaaaaaaatccagttcaacttgatgatgaaggaggcaggacatttttacgggtc
ctcatccatctaatcatgcatgactaccctcctctgctatcaggagccctgcagctgctg
ttcaagcacttcagccagagagcggaagttttacaggcatttaaacaggtgcagttactg
gtgtccaatcaggacgtagataactacaaacaaatcaaggcagacctagaccagcttcga
ctaactgtagaaaaatccgagttatgggttgagaagagcagcagctatgagaatggagaa
atgggtgaaaatcaagtaaaaggtggtgaagagccaattgaggactcaaacattttaagt
ccagtgcaagatggaacaaagaaacctcagattgacagcaataagagcaacaactaccgg
attgtaaaggagattttgattaggctaagtaaactctgtgtacagaataaaaagtgtcgg
aatcaacatcaacgattactgaaaaatatgggagcccattcagtggtgttagacctgctg
cagataccctatgaaaagaatgatgaaaagatgaatgaagtaatgaatctggcccataca
ttcctgcagaatttctgtcggggaaatccacagaatcaagttctcctccataaacatctg
aatttgttcttaacccctggtctccttgaagcagaaaccatgcggcacatcttcatgaac
aattaccatctgtgcaatgaaattagcgagagggttatccagcacttcgtgcactgcatt
gagacgcacggccgccacgtggagtacctgaggtttctgcagacgattgtcaaagcagat
ggtaaatatgtgaagaaatgccaggatatggtgatgaccgagttgataaatgggggtgaa
gatgtgctgatattttacaatgatagagcatcatttcccatccttctccatatgatgtgt
tcagagagagaccgaggggatgagagtggccccttagcctaccacatcacccttgtggag
ttgctggcagcatgcacagaggggaaaaatgtctacaccgaaatcaagtgcaattccctt
ctgcccctggacgacatagtgagggtggtgacccatgacgactgcatccctgaggttaaa
attgcttatgtgaattttgttaatcactgttatgttgacactgaagtggaaatgaaagaa
atctacacaagtaaccacatctggaaattatttgagaacttcttggtggatatggcaagg
gtttgcaacacaactacagacaggaaacacgcagacacctttttggagaagtgtgttact
gagtcaataatgaacattgtgagcggcttttttaattctcccttttcagacaacagtacc
agcctgcagacacatcagccagtttttattcagctgcttcagtctgccttcagaatttac
aattgcacctggccaaatccagcacagaaagcctcggtggagtcctgtatcagaactttg
gctgaagtggcaaagaatcgtggaattgccattccagtggatttggacggccaagttaat
actctttttatgaagagtcattccaatatggtacagagagcggccatgggttggagacta
tcagctcgctctggaccacgctttaaggaagctcttggagggccttcttgggattataga
aatattattgaaaagttacaggatgtagtggcgtccttggagcaacagttcagcccgatg
atgcaggctgaattctctgtgttggttgatgtgctgtacagtccagagctactgtttcct
gaggggagcgatgcaagaataagatgcggtgctttcatgtccaagttgattaatcataca
aagaaactgatggagaaagaagaaaaattgtgcattaaaattcttcaaactttacgagaa
atgctagagaagaaagacagctttgtggaagagggtactacattaagaaaaatactcctg
aatcggtactttagaggcgattatggtatctgtatgaacggacacctctctggagcctac
tgcaaatctgcacaaggaggaggaagcttttctggacaagattcagataagatggggata
tccatgtcagatattcagtgtctactggataaagaaggtgcatctgaacttgtcatcgat
gttatagtgaacaccaaaaatgacagaattttttcggaaggcattttacttggcattgcc
ttgcttgaaggaggaaatacacaaactcagtattccttctaccagcagttgcatgaacaa
aaaaagtcagaaaaattcttcaaagttctctatgaccgaatgaaggctgctcagaaagag
ataagatcaacagtgacagttaataccatagacttaggtaacaaaaaaagggatgatgac
aacgaattgatgacatctggaccacgaatgagagtaagagattcatcattacatttaaaa
gacggaatgaaagggcaattaacagaagcttcttcggcaacttccaaagcatactgtgca
tacagaagagaaatggatccagaaatagacatcatgtgcacaggatcagaagcgggaaac
gctgaggaaaagtctgcggaggaagtaacagtgagccctgccattgccatcatgcagccg
attctgagatttcttcagttactctgtgagaatcacaaccgggaactgcagaatttcttg
aggaatcaaaacaacaaaacaaattacaaccttgtctgtgagacccttcagtttttggac
tgcatttgtggaagtacgacgggtggcctgggcctcttgggtctctacatcaatgagaag
aatgtagtgctggtcaaccagactctggagagcttgactgagtattgccagggcccatgc
catgaaaatcagacatgtattgctactcatgaatctaatgggattgatatcatcattgct
ttgattctaaatgacataaaccctcttggtaaatatcgaatggacctggtgctccaacta
aagaacaatgcctccaagcttttgctggccatcatggaaagtagacatgacagtgagaat
gcagaaagaattctatttaacatgagacccagagaactggtggatgtggtgaagaatgcc
tataaccaaggattggaatgcgatcacggggatgatgagggcggagatgatggtgtttcc
ccaaaagatgttggacacaatatctatattctggcccatcagttggcacgccacaacaaa
ctcttgcagcagatgctcaaaccaggatccgatccagatgacggagatgaagccttaaag
tattatgccaaccacaccgcacagatcgagattgttcggcatgataggacaatggaacaa
atagtgtttcccgtccccaacatatgtgaatacctcacgcgagaatccaagtgccgtgtg
ttcaataccacggaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaacg
gaagatctctacaatgagatgaagtggcagaagaaaatcaggagtaaccctgccctgttc
tggttctcaaggcacatttctctctggggaagcatctccttcaacctggctgtgtttatc
aacttagctgtggctctcttctacccatttggggatgatggagatgaaggtacactttca
ccgttgttctcagttctgctttggatagcagttgcaatctgcacatctatgctgtttttc
ttctccaagcctgtgggtattcggccatttcttgtgtcagtaatgctcagatccatatat
acaataggtcttgggcctacgttaatacttcttggtgcagctaatctttgtaataaaata
gtatttctggtgagttttgtcggaaatcgtggcacgttcacccgagggtaccgagcggtc
atcctggatatggcctttctctaccacgtagcgtatgtcctggtttgcatgctgggcctc
tttgtccacgaattcttctatagcttcctgctttttgatttagtatatagagaagagact
ctgctcaatgtcataaaaagtgtcacacggaatggccgctccattattctaactgcagtc
ctcgccctcatccttgtctacctgttttccattattggattcctttttctgaaggatgac
ttcactatggaggtggataggctgaaaaacagaactccccttacaggtagcaatgcagtt
tctgctatgactttcgcttcaatcctgggaacatgtgaaaaggaaaactgctcacccaca
ataccagcttcaaatacagctgctgaggagtatgaagatggaattgaaaggacgtgtgac
accctccttatgtgcattgtgaccgtcctgaaccagggcctcaggaatggcggcggcgtg
ggagatgtgctgagaagaccctcaaaagatgagcccttgtttgctgcccgagtggtgtat
gaccttcttttttatttcattgtcatcatcatcgttcttaacttgatttttggggttatc
attgatacttttgcggatctcagaagtgaaaaacagaaaaaagaagaaattctaaagaca
acctgcttcatctgtggactcgagagggacaagtttgataataaaacagtttcttttgag
gagcacatcaagtcagaacacaatatgtggcattatttgtacttcctagtcctggtgaag
gtgaaagacccaactgaatacaccggacctgaaagttacgtggctcaaatgattgtggag
aagaatttggactggtttcctcggatgcgagctatgtccctcgttagcaatgaaggtgac
agtgaacaaaatgagattcggaacctgcaggagaagttggaatcgaccatgagtctggtc
aaacagctgtccggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaat
aagcagagactgggctttctcggatcaaacacaccccatgtgaatcatcacatgccacca
cactga

DBGET integrated database retrieval system