KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999332
Entry
102999332         CDS       T03086                                 

Gene name
MAPKAPK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04218  Cellular senescence
bacu04370  VEGF signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999332 (MAPKAPK2)
   04370 VEGF signaling pathway
    102999332 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102999332 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102999332 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102999332 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102999332 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999332 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    102999332 (MAPKAPK2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102999332 (MAPKAPK2)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102999332 (MAPKAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 102999332
NCBI-ProteinID: XP_007171725
UniProt: A0A383Z965
LinkDB
Position
Un
AA seq 406 aa
VPQPAATAATAPCCPTPAMFPNPPPPPQPPAPAQPHPPAQPPPQPPQQFPQFHVKSSLQI
KKNAIIDDYKVTTQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQC
PHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAI
QYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEV
LGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKSRIRMGQYEFPNPEWSEV
SEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKE
EMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1221 nt   +upstreamnt  +downstreamnt
gttccccagcccgccgccaccgccgccaccgcaccatgctgtccaacgccggcgatgttc
cccaacccgccgccgccgccgcaaccccccgccccggcccaacctcaccccccggcccag
ccgccgccgcagcccccgcagcagttcccccagttccacgtcaagtcgagcctgcagatc
aagaagaacgccatcatcgacgactacaaggtcaccacccaggtcctgggactgggcatc
aacgggaaagttttgcagatcttcaacaagaggacccaggagaaattcgctctaaaaatg
cttcaggactgccccaaggcccgccgggaggtggagctgcactggcgggcctcccagtgc
ccacacatcgtgcggatcgtggacgtctatgagaacctgtacgcggggaggaagtgcctg
ctgatcgtcatggagtgtttggatggtggagaactcttcagccgaatccaggaccgagga
gaccaggcattcacagaaagagaggcatcagagatcatgaagagcatcggcgaggcgatc
cagtacttacactcgatcaacatcgcgcatcgggatgtcaagcctgagaacctcttatac
acctccaaaaggcccaacgccattctcaaactcactgattttggctttgccaaggaaacc
accagccacaactctctgaccactccttgttacacgccatactatgtggctccagaagtg
ctgggcccagagaagtatgacaagtcctgtgacatgtggtccttgggtgtcatcatgtac
atcctgctgtgtgggtatccccccttctattccaaccatggccttgccatctctccgggc
atgaagagtcgcatccgaatgggccagtatgaattccccaacccagaatggtcagaagta
tcagaggaagtgaagatgctcatccggaacctgctgaagacagagcccacccagaggatg
accatcaccgagttcatgaaccacccctggatcatgcaatcaacgaaggtccctcaaacc
ccactgcacaccagccgcgtcctgaaggaggacaaggagaggtgggaggacgtcaaggag
gagatgaccagtgccttggccacgatgcgggtcgactatgagcagatcaagataaaaaag
attgaagatgcatccaaccctctgcttctgaagaggcggaagaaagctcgggccctggag
gccgcggccctcgctcactga

DBGET integrated database retrieval system