KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999338
Entry
102999338         CDS       T03086                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04380  Osteoclast differentiation
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05135  Yersinia infection
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999338 (NFATC1)
   04310 Wnt signaling pathway
    102999338 (NFATC1)
   04024 cAMP signaling pathway
    102999338 (NFATC1)
   04022 cGMP-PKG signaling pathway
    102999338 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102999338 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102999338 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    102999338 (NFATC1)
   04660 T cell receptor signaling pathway
    102999338 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    102999338 (NFATC1)
   04659 Th17 cell differentiation
    102999338 (NFATC1)
   04662 B cell receptor signaling pathway
    102999338 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102999338 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102999338 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102999338 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102999338 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102999338 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102999338 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102999338 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    102999338 (NFATC1)
   05161 Hepatitis B
    102999338 (NFATC1)
   05163 Human cytomegalovirus infection
    102999338 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999338 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    102999338 (NFATC1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102999338 (NFATC1)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 102999338
NCBI-ProteinID: XP_007172836
UniProt: A0A383ZCR1
LinkDB
Position
Un
AA seq 901 aa
MFAQREAPVGACPKHYSYVTSGIGSGLPLSSAHPSLPAPCHDLQTSAPGISSAGYGAALD
GGPSSYFLSSGGVRPNGAPALESPRIEITSYLGLHHGNGQFFHDVDVEDVLPSSKRSPST
ATLNLPNLEAYRDPSCLSPASSLSSRSCNSEASSYESSFSYPYASPQTSPWQSPCVSPKT
TDPEEGFPRGLGACGLLGSPRHSPSTSPRASVTEESWLGARTSRPSSPCNKRKYGLNGRQ
LSCSPHPSPTPSPQGSPRVSVTDDTWLGNTTQYTSSAIVAAINALSTDGSLDLGDGVPVK
ARKTALDHSPSVALKVEPAGEDLGATPPTSDFPPEEFPSFQHIRKGAFCDQYLSVPQHLY
PWARPRSPTSYTSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKALAG
GHPSVQTALSLGGALGWGGAGPLSAALPSTQLGSREHPTCTLKGGAAPSRRAGPPVSFSS
TGRWALVSTGGRLGPAVGQALPSGTHDGGRGGRPLSSSSIDCAGILKLRNSDIELRKGET
DIGRKNTRVRLVFRVHVPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSAASGPVLGG
KRMVLSGHNFLQDSKVIFVEKAPDGHHIWEMEAKIDGALCKPNSLVVEIPPFRNQRITSP
VQVNFYVCNGKRKRSQYQHFTYLPANVPIIKTEPSDDYEPALTCGPMSQGLSPLPKPCYG
QPLALPPDPGSCLVPGFPPRPQSSASPELHDLSCAPYGRGCWSRGALAGTTCCRLGFARR
AVAPFRQGRRDQPCTTAHTANSAPCHFQARRAIARPDPKVTVLKARAPGVPREVADAGGV
VTRRLYLPRWSPPGPGLKPPPGGAEPPPAHFRFAHPAEDLGKERAQPFTCGSFTSRLYEQ
E
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgtttgcgcagagggaagccccggtgggcgcgtgtccaaagcactacagttacgtcacc
tccggcatcggctctggcctgcccctctcctccgcccacccctcgctgccggccccgtgc
cacgacctgcagacctcggccccgggcatctcctcagcaggctacggggctgccctggac
ggcgggccctcgagctacttcctctcctccggcggagtcaggcccaacggggccccggcc
ctggagagcccccgcatcgagatcacctcctacctggggctgcaccatggcaacggccag
ttcttccatgacgtggacgtggaagacgtccttcccagctccaagcggtcgccgtccacg
gccaccctgaacctgcccaacctggaggcctaccgcgacccctcgtgcctgagcccggcc
agcagcctgtcgtcccgcagctgcaactccgaggcctcatcctacgagtccagcttctcg
tacccgtacgcgtccccgcagacgtccccgtggcagtccccctgcgtgtcccccaagacc
acagaccccgaggagggcttcccccgtggcctgggggcctgcggcctgctcgggtccccg
aggcactcgccctccacctcgccgcgcgccagtgtcaccgaggagagctggctgggggcc
cgcacgtccaggccctcgtccccctgcaacaagcggaagtacggcctcaacggccggcag
ctgtcctgctccccccacccctcgcccacgccatccccgcaaggatcgccacgggtcagc
gtcaccgacgacacctggctgggcaacaccacgcagtacaccagctcggccatcgtggct
gccatcaacgccctgagcaccgacggcagcctggacctgggcgacggcgtccccgtcaag
gcccgcaagaccgccctggaccactcgccctcagtggcgctcaaggtggagccggcgggg
gaggacctgggggccacgccgcccacgtctgatttcccacccgaggagttcccgtccttc
cagcacatccgcaagggcgccttctgcgaccagtacctgtcggtgccgcagcacctgtac
ccgtgggcccggccgcggtccccgacgtcctacaccagcccgtctctccctgccctcgac
tggcagctgccgtcacactcaggaccgtacgagctgaggatcgaggtgcagcccaagtcc
caccacagagctcattacgagacggaggggagccggggggccgtgaaggcgttggccgga
ggacaccccagtgtgcagacggctctgtctctggggggcgctctgggttgggggggtgct
ggccccctgagcgctgccctgcccagcacgcagctgggaagccgcgagcaccccacctgc
acactcaagggtggggcggcgccgtctcgccgagccgggcctcccgtctccttctcctcc
acgggacgctgggctctggtcagcacaggtggccggctcggccctgctgtgggccaggcc
ctgcccagcgggactcatgatggtggccgtggcggccgtcccctcagcagcagcagcatc
gactgcgccgggatcctgaagctcagaaactctgacatcgagctccgcaagggggagacg
gacatcgggaggaagaacacgcgggtgaggctggtcttccgcgtccacgtcccgcagccc
aacggccggacgctgtcgctgcaggtcgcctccaaccccatcgagtgctcccagcgctcg
gcccaggagctgcccctcgtggagaagcagagcgcggccagcggccccgtcctcggcggg
aagaggatggtcctgtccggccacaactttctgcaggactccaaggtcattttcgtggag
aaagcaccagacggccaccacatctgggagatggaggcgaaaatcgacggagccctgtgc
aagccgaattcgctggtggtcgagatcccgccttttcgcaaccagaggatcaccagcccc
gtccaggtcaacttctacgtctgcaacgggaagagaaagaggagccagtaccagcacttc
acctacctgcccgccaatgttccaatcataaaaacggagcccagcgatgattacgagcct
gccctcacctgtggaccaatgagccagggcctgagcccgctccccaagccctgctacggc
cagccgctcgccctgccgcctgacccgggctcctgcctcgtgcccggcttcccgccccgc
ccccagagcagcgccagccccgagctccacgacctctcctgcgccccctacggacgcggt
tgctggtcccggggggcgctggcgggtacgacctgctgtcgcctgggctttgcccggaga
gccgtggcgccgttccgccagggcaggagggaccagccgtgcaccacggctcacacagcg
aactcagccccatgtcacttccaggcacgcagagccattgcgcgtcccgaccccaaggtg
acagtccttaaggcccgggcccctggggtgccacgggaggtggcggatgccggtggcgtg
gtgacccgcaggctgtatctcccgaggtggagtccaccggggcccgggctgaagccgcca
cccggaggagcggagcccccgcccgctcacttccgctttgcccacccggcggaagacctg
ggcaaggagagggcccagccgttcacctgtggctccttcacctcgcgactgtacgagcag
gagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006784
Entry
103006784         CDS       T03086                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04625  C-type lectin receptor signaling pathway
bacu04921  Oxytocin signaling pathway
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103006784 (NFATC4)
   04022 cGMP-PKG signaling pathway
    103006784 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103006784 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103006784 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103006784 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    103006784 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103006784 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    103006784 (NFATC4)
   05161 Hepatitis B
    103006784 (NFATC4)
   05163 Human cytomegalovirus infection
    103006784 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103006784 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103006784 (NFATC4)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    103006784 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 103006784
NCBI-ProteinID: XP_007180707
UniProt: A0A384A014
LinkDB
Position
Un
AA seq 901 aa
MGAASCEDEELEFKLVFGEEKEAPPLGAGGSGEELDSEDTPPCCRLGLGEPPPYGAAPIG
IPRPPPPRPGMLSPPPRPAPSPGTWESQPARSVRLGGPGGGSGGAGGGRVLECPSIRITS
ISPTPDPPAALEDNPDAWGEGSPRDYPPPEGFGGYREAGGLGGGPFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLVRDPGSPGPFDYAGAPPAESIPQKTRRTSSEQAVALPRSEEPAPCNGKLPSGVEE
AGAPPGGPRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPIVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGSGKVISVQTASVPIECSQRSAQELPQVEAYSPSACSVTG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRSQSNEVTLTLTIPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDASLRGFPSASGPHFGSDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFSYGTPPLYPQTGPPPSYRPGPRMFPETGGTTGCARPPPV
SFLPRPFPSDPYGGRGSPFPLGLPFPPPAPFRPPLPSSPPLEGPFAPQSSVHPPPAEGYN
EVGPSYGPGEGAPEQEKSRGGYGSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPP
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggggcagcaagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaggcccccccgctgggcgcgggggggtcgggggaagaactggactcagaggacacc
ccaccatgctgccgtctgggcctgggggagccccctccctatggcgctgcccctattggc
attccccggcctccaccccctcggcctggcatgctctccccaccaccccgcccggccccc
tcacctggcacttgggagagccagccagcccggtcagtgaggctgggggggccgggaggg
ggctccgggggggctgggggaggccgtgttcttgagtgtcccagcatccgcatcacctct
atctctcccactcctgacccgccagctgcgctggaggacaacccagatgcctggggggaa
ggctcccccagggattaccccccaccggaaggctttggaggctaccgagaggcagggggc
ctgggcgggggccccttcttcagcccgagccctggcagcagcagcctgtcttcctggagc
ttcttctccgatgcctccgacgaggcagccttgtatgcagcctgtgacgaggtcgagtcg
gagctaaatgaggcggcctcccgctttggcctgggctccccactgccctcaccccgggcc
tcccctaggccgtggacccccgatgacccctggagcctgtatggtccgagccctggaggc
cggggtccagaggatagctggctactcctcagcgctcctgggcccaccccagcttcccca
cgacccgcctctccatgtggcaagcggcgctattccagctcaggaaccccatcttcggcc
tccccagctctgtcccgccgaggcagcctaggggaggaggggcctgagccacctccaccg
cccccattgcctctggtccgggaccctggctcccctggcccctttgactatgcgggggcc
ccaccagccgagagcatcccccagaagacccggaggacttccagcgagcaggcggtggcc
ctgcctcggtctgaggagcctgccccgtgcaatgggaagctgccttcaggagtagaggag
gccggggctccccccgggggtcctcggaaggaggtggccggcatggactacctggcggtg
ccttccccactggcttggtccaaggcccggattggggggcacagccccatcttcaggacc
tctgccctccccccgctggactggcctctgcccagccagtatgagcagctggagctgagg
atcgaggtgcagcccagagcccaccaccgggcccactatgagacagagggcagccgggga
gctgtcaaagctgcccctggtggtcaccccatcgtcaagctcctaggctacagtgagaag
ccactgaccctacagatgttcatcggcaccgcagatgagaggaacctgcgacctcacgcc
ttctatcaggtgcaccgtatcacgggcaagatggtggccacggccagctacgaagctgta
gtcagtggtaccaaggtgttggagatgaccctgcttcctgagaacaacatggccgccaac
attgactgtgccggaatcctgaagcttcggaattcagacattgagctgcggaagggtgag
acggacatcgggcgcaagaacacacgcgtgcggctggtattcagggtacacgtgccccaa
ggcagcgggaaggtcatctcggtgcagacagcatcggtgcccatcgagtgctcccagcgc
tcagctcaggagctgccccaggtggaggcctacagccccagtgcctgctccgtgacagga
ggggaggaactagtgctgaccggctccaacttcctgccagactccaaggtggtgttcatc
gagaggggccctgatggaaagctgcaatgggaggaggaggccacagtgaaccggtcacag
agcaatgaggtgacgctgaccctgaccatccctgagtacagcaacaagcgggtgtcccgg
ccagtccaggtctacttttacgtctccaacgggcggaggaagcgcagtcctacccagagt
ttcaagttcctgcctgtgatcttcaaggaagagcctctaccagacgcatctctccggggc
ttcccttcagcatcgggcccccattttggctctgacatggacttctcaccacccaggccc
ccctacccctcctatccccatgaagaccctgcttatgaaactccttacctgtcagaaggc
ttcagctatggcacgccccctctgtacccccagacggggcccccaccatcctacagacct
ggcccgcggatgttccctgagactgggggtaccacaggttgtgcccgcccacctccagtc
tcattccttccccggcccttccctagtgacccctatggaggacggggctccccctttccc
ctggggctgccgttccctcctccagcccccttccggcctccactgccttcatccccacca
cttgaaggccccttcgctccccagagcagtgttcaccccccacctgctgagggatacaat
gaggtagggccaagctatggccctggggagggggctccggagcaggagaaatccaggggt
ggctacggcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcctccc
gcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017260
Entry
103017260         CDS       T03086                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04625  C-type lectin receptor signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04921  Oxytocin signaling pathway
bacu05135  Yersinia infection
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017260 (NFATC3)
   04310 Wnt signaling pathway
    103017260 (NFATC3)
   04022 cGMP-PKG signaling pathway
    103017260 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103017260 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103017260 (NFATC3)
   04660 T cell receptor signaling pathway
    103017260 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    103017260 (NFATC3)
   04659 Th17 cell differentiation
    103017260 (NFATC3)
   04662 B cell receptor signaling pathway
    103017260 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103017260 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    103017260 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103017260 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103017260 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017260 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    103017260 (NFATC3)
   05161 Hepatitis B
    103017260 (NFATC3)
   05163 Human cytomegalovirus infection
    103017260 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103017260 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103017260 (NFATC3)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    103017260 (NFATC3)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103017260
NCBI-ProteinID: XP_007198377
UniProt: A0A384BF65
LinkDB
Position
Un
AA seq 998 aa
MVLCISDLEPDDCASIYIFNVDPPPSTLNSPLCLPHHGLPSHSSVLSPSFQLQGHKNYEG
TCEIPESKYSPLGGPKPFECPSIQITSISPNCHQEIDAHEDDLHINDPEREYLERPSRDH
LYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSP
LTSPGGSPGGCPGEESWNQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPT
SPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVQGGSGLGPALFPF
QYCVETDIPLKTRKTSEDQATVLPGKLELCSDDQGNLSPSRETSIDDGLGSQYPLKKDSS
GDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPLDWPLPTHFGQYELKIEVQPKTHHRAHYE
TEGSRGAVKASTGGHPVVKLLGYSEKPINLQMFIGTADDRYLRPHAFYQVHRITGKTVAT
ASQEIIIASTKVLEIPLLPENNMSVSIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVF
RVHIPQPNGKVLSLQTASIPVECYGRPQWEVEGKIIKEKCQGAHIVLEVPPYHNPAVTAA
VQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPHPVQTQRPSSDTGHLH
DSVLSAQRSLVCPIQLTYASMVTSAHLPQLQCRDESAGKEQHMIPSSVVHQPFQVTPTPP
VGSSYQPMQTNVVFNGPTCLPVNAASSQEFDPVLFQQDAALPNLINLGCQPPSSIPFHSS
NSGSTGHLLAHTPHSVQTLPHLPSMGYCCSNTGQRSLSSPVADQVTGQPSPQLQPITYGP
SHSGTATTASQAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSQSLATRMHSGQHSTQ
AQSTGQGGLSAPSSLLCHSLCDPASFPPDEATVNIKPEPEEQEPNFSTIGLQDITLDDVN
EVIGRDMSQISVSQGTGASRQAPLPGPDSLDLGRSDGL
NT seq 2997 nt   +upstreamnt  +downstreamnt
atggtcctgtgcatttcagatcttgagccagatgattgtgcatccatttacatctttaat
gtagatccacctccatctactttaaactcaccactttgcttaccacatcatggattaccg
tctcactcttctgttttgtcaccatcgtttcagctccaaggtcacaaaaactatgaagga
acttgtgaaattcctgaatctaaatacagcccattaggtggtcccaaaccctttgagtgc
ccaagtattcaaattacatccatctctcctaactgtcatcaagaaattgatgctcatgaa
gatgacctacacataaatgacccagaaagggaatatttggaaaggccttctagagatcat
ctctatcttcctcttgagccatcctaccgggagtcttcccttagtcctagtcctgccagc
agcatctcttctaggagctggttctcagatgcgtcttcttgtgaatctctttcacatatt
tatgatgatgtggattcggagttgaatgaagctgctgcccgatttactctcggatcccct
ctgacttctcctggtggctccccaggaggctgccctggagaagagtcctggaatcaacag
tatggacttggacactccttgtcacctaggcaatctccttgccactctcctagatctagt
gtcactgatgagaattggctgagccccaggccagcctcaggaccctcatcaaggcctact
tccccttgtgggaaacggcggcactctagtgctgaggtttgttatgctgggtccctttcg
cctcatcactcacctgttccttctcctggtcactcccccaggggaagtgtaacagaagat
acctggctcaatgcttctgtccagggtggatcaggccttggccctgcactttttccattt
cagtactgtgtagagactgatattcctctgaaaacaaggaagacttctgaagatcaagct
accgtactaccaggaaaattagagctctgttcagatgaccaagggaatctttcaccgtcc
cgggaaacttcaatagatgatggccttggatctcagtatcctttaaagaaagattcatct
ggtgaccaatttctttcagttccttcaccctttacctggagcaaaccaaagcctggtcac
acccctatatttcgcacgtcttcattacctccactagactggcctttaccaactcatttt
ggacaatatgaactgaaaatagaagtgcaacctaaaactcatcatcgagcccattatgaa
actgaaggtagccgaggagcagtaaaagcatctactgggggacatcctgttgtgaagctc
ctgggctatagtgaaaagccgataaatctacagatgtttattggaacagcagatgatcga
tatttacggcctcatgcattttaccaggtgcatcggatcactgggaagacagttgctact
gcaagccaagagataataattgccagcacaaaggttctggaaattccacttcttcctgaa
aacaatatgtcagtcagtattgactgtgcaggtattttgaaactccgcaattcagatata
gaacttcgaaaaggagaaactgatattggcagaaagaatactagagtacgacttgtgttt
cgtgtacacatcccacagcccaatggaaaagtcctttctctgcagacagcttctatacct
gttgaatgctatggacgacctcagtgggaagtagaagggaaaataatcaaagaaaaatgt
caaggggctcacattgtccttgaagttcctccatatcataacccagcagttacagctgca
gtgcaggtgcacttttatctttgcaatggcaagaggaaaaaaagccagtctcaacgtttt
acttacacaccagttttgatgaagcaagaacacagagaagagattgatttgtcttcagtt
ccgtcattgcctcatcctgtccagacccagaggccttcttcagatacaggacacctacat
gacagtgtactgtctgcacagagaagcttggtttgtcccatccagctaacatatgcatcc
atggtaacctcagcccatctgccacagttgcagtgtagggatgagagtgctggtaaagaa
cagcatatgataccttcttcagttgtgcaccagccttttcaagtcacaccaacacctcct
gtagggtcttcctatcagcctatgcaaactaatgtcgtattcaatggaccaacttgtctt
cctgttaatgctgcctctagtcaagaatttgatccagttttgtttcagcaggatgcagct
cttcctaatttaataaatcttggctgtcagccaccatcatccataccttttcattcttca
aattcaggctcaacaggacatctcttagcccacacacctcattctgtgcagaccttgcct
catctgccgtcaatgggatactgttgttcaaacacaggacaaagatctctttcttctcca
gtggctgatcaggtcacaggtcagccttcccctcagttacaacccattacgtatggtcct
tcacattcagggactgctacaacagcttcccaagcagcctctcatcccttggccagttca
ccactttctgggccaccatctcctcagctacagcctatgccttaccagtctcctagctca
ggaactgcctcatcacagtctctagccaccagaatgcattctggacagcactcaactcaa
gcacaaagtacaggccagggaggtctttctgcaccttcatccttattatgtcacagtttg
tgcgatccagcttcatttccacctgatgaggcaactgtgaacattaaacctgaacctgaa
gagcaagaacctaacttttctacaattggtcttcaggacatcactttagatgatgtgaat
gaggtaattgggagagacatgtcccagatttctgtttcccaaggaacaggggcgagcagg
caggctcccctcccaggtcctgattccctggatttaggaagatccgacgggctctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017564
Entry
103017564         CDS       T03086                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04921  Oxytocin signaling pathway
bacu05135  Yersinia infection
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103017564 (NFATC2)
   04370 VEGF signaling pathway
    103017564 (NFATC2)
   04022 cGMP-PKG signaling pathway
    103017564 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103017564 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103017564 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    103017564 (NFATC2)
   04660 T cell receptor signaling pathway
    103017564 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    103017564 (NFATC2)
   04659 Th17 cell differentiation
    103017564 (NFATC2)
   04662 B cell receptor signaling pathway
    103017564 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103017564 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    103017564 (NFATC2)
   04380 Osteoclast differentiation
    103017564 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103017564 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103017564 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017564 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    103017564 (NFATC2)
   05161 Hepatitis B
    103017564 (NFATC2)
   05163 Human cytomegalovirus infection
    103017564 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103017564 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103017564 (NFATC2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    103017564 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 103017564
NCBI-ProteinID: XP_007185511
LinkDB
Position
Un
AA seq 803 aa
MQAGGPFRVRDTGLLVEQPPLPGVGASPRFTLPVPGFEGYREPLCLSPASSGSSASFISD
TFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTGLAEDSCLGRHSPVPRP
ASRSSSPGTKRRHSCAGALVAPLPGASPQRSRSPSSRSPSPQPRDDGAPAGYPPAAGSAA
LMDALNSLAADSPCGIPTKMWKTSPDPSPVSTAPSKAGLPRHIYPAVEFLGPCEQEERRN
SAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRA
HYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGK
TVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRV
RLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQN
FTAESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTSVKVNFYVIN
GKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGSQPYYPQHPMVAESPSCLV
ATMAPCQQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHR
SVLVHAGSQGQSSALLHSSPANQQASPVIHYSPTNQQLRCGSHQEFQHIVYCENFAPGTT
RPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQ
TYLDDVNEIIRKEFSGPPARNQT
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgcaggcaggggggcccttccgcgtgagagacactggcctcctggtggagcagccgccc
ctgccgggggtgggcgccagcccgaggttcacgctgcccgtgcccggcttcgagggctac
cgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttccgac
accttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgacctg
tgtccccagtttcaaaacatccctgctcattattcccccagaacctcgccaataatgtca
cctcgaaccggcctcgctgaggacagctgcctgggccgccactcgcccgtgccccgtccg
gcctcccgctcctcgtcgcctggtaccaagcggaggcattcgtgcgctggggccttggtt
gccccgctgcccggagcctcaccccagcgctcgcggagcccctcctcgcggagcccctcg
ccgcagccccgggacgacggcgcccctgccgggtacccccccgcggcgggctctgccgcc
ctcatggatgccctgaacagcctcgctgccgactcgccctgtgggatccccaccaagatg
tggaagaccagccccgacccgtcgccggtgtccaccgccccgtccaaggctggcctgccc
cgccacatctacccggccgtggagttcctggggccctgcgagcaggaggagaggaggaac
tcagcccccgagtccattttgctggtgccaccaacttggcccaagcagctggtgcccgcc
attcccatctgcagcatcccagtgactgcatccctccctccacttgagtggccactctcc
caccagtcaggctcctatgagctgaggatcgaggtgcagcccaagccacatcaccgagct
cactacgagacagaaggcagccgaggggctgtcaaagctccgaccggcggccaccctgtg
gttcagctccatggctacatggaaaacaagccgctggggcttcagatcttcattgggacg
gccgacgagcggatccttaagccccatgccttctaccaggtacaccggatcacggggaaa
accgtcaccaccaccagctacgagaagatcgtgggcaacaccaaagtcctggagattccg
ctggagccaaaaaacaacatgagggcaaccattgactgtgcggggatcctgaagcttcgg
aatgcggacattgagctgcggaaaggcgagacggacatcgggaggaagaacacgcgggtg
aggctggtgttccgggtgcacattccagagtccagcggaaggatcgtctccttgcagaca
gcatctaaccccatcgagtgctcccagcgatccgcccatgagctgcccatggtggaaaga
caagacatcgacagctgcctggtctatgggggccagcagatgattctcacgggacagaac
ttcacggccgagtccaaagtcgtgtttaccgagaagaccacagatgggcagcagatttgg
gagatggaggccacggtggataaagacaagagccagcctaacatgctttttgttgagatc
cctgagtatcggaacaagcacattcggacatccgtgaaggtgaacttctacgtcatcaac
gggaaaagaaaacgaagtcagcctcagcactttacctaccacccagtcccagccatcaag
acggagcccaccgatgaatacgaccccaccttgatctgcagccctgcccacgggggcctg
gggagccagccttactacccacagcacccaatggtggccgagtccccctcctgcctcgtg
gccaccatggctccctgccagcaattccgctcagggctctcatcccccgacgcccgctac
cagcagcagaacccagcggccgtcctctaccagcggagcaagagcctgagccccagcctg
ctgggctaccagcagccggccctcatggccgcccccctgtccctcgcggatgcccaccgc
tctgtgctagtgcacgctggctcccagggccagagctcggccctgctccactccagtcca
gccaaccagcaggcctcaccggtgatccactactcgcccaccaaccagcagctgcgctgc
ggaagccaccaggagttccagcacatcgtgtactgcgagaacttcgcgcccggcaccacc
aggcccggcccaccccctgtcagtcaaggtcagaggctgagcccgggctcctaccccacg
gtcattcagcagcagaatgccacaagccaaagagccgccaaaaacggacctccagtcagt
gaccaaaaggaagtattacccgcgggcgtgacaattaaacaggagcagaacttggaccag
acctacttggatgacgttaatgaaattatcaggaaggagttttcaggacctcctgcccga
aatcagacgtag

DBGET integrated database retrieval system