KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999370
Entry
102999370         CDS       T03086                                 

Gene name
CDH1
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04015  Rap1 signaling pathway
bacu04371  Apelin signaling pathway
bacu04390  Hippo signaling pathway
bacu04514  Cell adhesion molecules
bacu04520  Adherens junction
bacu05100  Bacterial invasion of epithelial cells
bacu05200  Pathways in cancer
bacu05213  Endometrial cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102999370 (CDH1)
   04390 Hippo signaling pathway
    102999370 (CDH1)
   04371 Apelin signaling pathway
    102999370 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102999370 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102999370 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999370 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102999370 (CDH1)
   05216 Thyroid cancer
    102999370 (CDH1)
   05218 Melanoma
    102999370 (CDH1)
   05219 Bladder cancer
    102999370 (CDH1)
   05213 Endometrial cancer
    102999370 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102999370 (CDH1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102999370 (CDH1)
Cell adhesion molecules [BR:bacu04515]
 Cadherins
  Major cadherins
   102999370 (CDH1)
CD molecules [BR:bacu04090]
 Proteins
  102999370 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2
Other DBs
NCBI-GeneID: 102999370
NCBI-ProteinID: XP_007198242
UniProt: A0A384BES7
LinkDB
Position
Un
AA seq 887 aa
MGPPCRSRSALLLLLLLLLQVSSWLCQEPEPCNPGFGAESYTFAVPRLHLERGRVLGRVS
FEGCTGLPRTVYVSDDTRFKVGTDGVVTVKRPLHLHHPEMSFLVHAWDSTRRKLSTKVTL
KAVVHRHRHHHHHDSPSGTQTEVLTFPSSHHGLRRQKRDWVIPPISCPENEKGPFPKALV
QIKSNRDKETKVFYSITGQGADTPPLHVFIIERETGWLKVTEPLDREDIAKYILFSHAVS
SNGQAIEEPMEIVITVTDQNDNKPEFTQTVFKGSVMEGALPGTSVMEVSATDADDDVNTY
NAAIAYSILSQEPVLPHNKMFTINRDTGVISVLTTGLDRESFPTYTLVVQAADLQGDGLS
TTATAVITVTDTNDNPPIFNPTTYVGSVLENEANVVITTLTVTDADVPSTPAWEAVYKIL
NDNEKQFVVITDPVTNGGILKTAKGLDFEAKQQYILYVAVTNAVPFEVTLSTSTATVTVD
VIDVNEAPIFMPPQKKVKVPEDFGLGLEITSYTAQEPDKFMEQKITYRIWRDAANWLEIN
PDTGAISTRAELDRENVEHVKNSTYMALIIATDNGSPPATGTGTLLLFLDDVNDNGPIPE
PRNMDFCQRNPQPYIINIIDPDLPPNTSPFTAELTHGASVNWTIEYNDQEHESLIFKPKK
TLEVGDYKINLKLIDNQNKDQVTTLDVHVCDCEGVVSNCRKAGPYAEAGLQVPAILGILG
GILAFLILILLLLLLVRRRRVVKEPLLPPEDDTRDNVYSYDEEGGGEEDQDYDLSQLHRG
LDARPEVTRNDVAPTLLSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDY
EGSGSEAASLSSLNSSESDRDQDYEYLNEWGNRFKKLADMYGGGEDD
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgggccctccgtgccgcagccgctctgcgctcctgctgctgctgctgctgctgctgcag
gtctcatcgtggctctgccaggagccggagccctgcaatcccggctttggcgccgagagc
tacacgttcgccgtgccccggctgcacttggagagaggccgagtcctgggcagagtgagt
tttgaaggatgcaccggtctaccaaggacagtctatgtttctgatgacacccgattcaaa
gtgggcacagatggcgtggttacagtcaaacggcctttacaccttcatcatccagagatg
agttttcttgtccacgcctgggactccacccgcaggaagctctccaccaaagtgaccctg
aaggcagtagtgcaccgccatcgccaccaccatcatcatgactctccctctggaacccag
acagaagtgctcacatttcccagctcccaccatggtctcaggagacagaagagagactgg
gttattcctcctatcagctgcccagaaaatgagaaaggcccatttcctaaggctctggtt
cagatcaaatctaacagggacaaagaaaccaaagttttctacagcatcactggccaagga
gccgacacaccccctcttcatgtgtttattattgaaagagaaacaggatggctaaaggtg
acggaacctctggatagagaagacattgccaagtacattctcttctctcatgctgtgtct
tcgaacgggcaagcaatcgaggagccgatggagattgtgatcaccgtgactgatcagaat
gacaacaagcctgagttcacccagacggtcttcaaggggtctgtcatggagggcgctctt
ccagggacctctgtgatggaggtttcagccacagacgcagacgatgatgtgaacacctac
aacgctgccattgcttactctatcctcagccaagagcctgtgctgccacacaacaaaatg
ttcaccatcaacagggacacgggcgtcatcagtgtgctcaccaccgggctggaccgggag
agttttcccacgtataccctggtggttcaagctgcagaccttcaaggtgacggcttaagc
acgaccgcaacagctgtgatcacagtcactgacaccaacgataaccctcccatcttcaac
ccaaccacgtacgtggggtcggtgcttgagaacgaggctaacgtggtcatcaccacactc
acagtgaccgatgccgacgtccccagtaccccagcgtgggaggccgtttacaaaatatta
aatgataacgagaagcagtttgttgtcatcacagacccagtaaccaatggtggcattttg
aagacggctaagggcttggattttgaggccaagcagcagtacatcctgtatgtggcagtg
actaatgcggtcccctttgaggtcactctctccacttccacagccaccgtcaccgtggac
gtgatagatgtgaacgaagcccccatcttcatgcctcctcagaagaaagtgaaagtgccc
gaggacttcggcttgggcctggagatcacgtcctacaccgcccaggagccagacaaattt
atggaacagaagatcacgtatcggatttggagggacgctgccaactggctggagattaat
ccggacacgggtgccatttccactcgggctgagttggacagagagaacgtcgagcatgtg
aagaacagcacgtacatggccctcattatagccactgacaatggttctccacctgctact
ggaacgggaacgctgctcctattccttgatgacgtgaatgacaatggccccataccagaa
cctcggaacatggacttctgccagaggaatccacagccttatatcatcaacatcattgat
cctgatcttccccccaacacttctcccttcacagcagaactaacacatggggcaagtgtc
aactggaccattgagtacaatgaccaagaacatgaatctctgatttttaagccaaagaaa
accctagaggtgggtgactacaaaatcaatctcaagctcatagacaaccagaacaaagac
caagtgaccaccttagatgtgcacgtgtgtgactgtgaaggggtcgtcagcaactgtagg
aaggccgggccttacgccgaagcaggattgcaagttcccgccattctggggattcttgga
ggcattcttgcttttctgatcctgattctgctgcttctgctacttgttcggaggagaagg
gtagtcaaagagcccttactgcccccagaagacgacacccgggacaacgtttattcctat
gatgaagaaggaggtggagaagaagaccaggactatgacctgagccagctacacaggggc
ctggatgctcggcctgaagtaactcgcaatgacgtggcgccaacgctcctgagtgtgccc
cagtatcgaccgcgacctgccaatcctgatgagattggaaactttattgatgaaaacctg
aaggcagctgatagtgaccctaccgccccaccctatgactctctgctggtgtttgattat
gaaggaagcggttccgaagctgctagtctgagctccctgaactcctcggagtcagaccga
gaccaggactatgagtacctgaacgaatggggcaatcgcttcaagaagctggcggacatg
tatggaggcggcgaggacgactag

DBGET integrated database retrieval system