KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999413
Entry
102999413         CDS       T03086                                 

Gene name
GAB1
Definition
(RefSeq) GRB2 associated binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu05100  Bacterial invasion of epithelial cells
bacu05205  Proteoglycans in cancer
bacu05211  Renal cell carcinoma
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102999413 (GAB1)
   04014 Ras signaling pathway
    102999413 (GAB1)
   04072 Phospholipase D signaling pathway
    102999413 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102999413 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102999413 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102999413 (GAB1)
   05226 Gastric cancer
    102999413 (GAB1)
   05211 Renal cell carcinoma
    102999413 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102999413 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102999413 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    102999413 (GAB1)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   102999413 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_13 PH_9 PH_8 PH_3
Other DBs
NCBI-GeneID: 102999413
NCBI-ProteinID: XP_007189415
UniProt: A0A384APY8
LinkDB
Position
Un
AA seq 751 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDPVKPPGSSLPAPADLPLAINTAPPSTQGDASSAAPPPPYQLISLPPHLETLGIQEDP
QDYLLLINCQSKKPEPTSQGSSFVSEEGEEYLLLEDFESKTIPLQTHADSAKSTPSETDC
NDNVPAHKNPASSQSKHGVNGFFQQQMMYDSPPSRAASVSVDSSLYNLPRSHSHDVLPKV
SPSSTEADGELYVFNTPSGTSSVEPQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSK
LDTIPDIPPPRPPKPHPAHDRSPVDTCSITRTASDTDSSYCIPTAGVPPSRSNTISTVDL
NKLRKDASSQDCYDIPRTFPTDRSSSLEGFHNHFKIKNVLTVGSVSSEELDENYVPMNPN
SPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVAD
CEPPPVDRNLKPDRKGQSPKILRPKPHGLERTDSQTIGDFATRRKVKPAPLEIKPLPEWE
ELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDSNL
FGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVD
QQKTLALKSTREAWTDGRQSTESETPAKNVK
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgagcggcggtgaagtggtctgctctggatggctccgcaagtcacccccggagaaaaag
ttgaagcgttatgcctggaagaggagatggtttgtgttacgcagtggccgtttaactgga
gatccagatgtcttggaatattacaaaaatgatcatgccaagaagcctatccgtatcatt
gatttaaatttatgtcagcaagttgatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacaccattgaccggattttctacttggtcgcagacagt
gaagaggagatgaataagtgggttcgttgtatttgtgacatctgtgggtttaatcctaca
gaagaagatcccgtgaagccacctggcagctccttaccagcaccagctgatttaccgctg
gcgataaatacagcaccaccgtccacccagggggatgcctcctcagctgcgccacctcct
ccgtatcagctaattagccttccaccacacctggaaacccttggcatccaggaggatcct
caggactacctcttgctaatcaactgtcaaagcaagaagcctgaacccaccagccaaggg
tcatcttttgtttctgaagaaggagaggaatacctactgctagaagattttgaaagcaaa
acgatcccattgcaaacgcacgctgattctgcgaaatccaccccttcggagacagactgc
aatgataacgtccctgctcataaaaatcctgcttcctcccagagcaaacatggagtgaat
ggctttttccagcagcagatgatgtatgactctccaccgtctcgggctgcatccgtttcc
gtagactccagcctttataacctgcccagaagtcactcccacgacgtcttaccaaaggtg
tctccttcaagtaccgaagctgacggagagctctatgtttttaataccccatccgggacc
tcgagtgtagagcctcaaatgaggcatgtatctattagttatgacattcctccaacacct
ggtaatacttatcagattccacgaacatttccagaaggaaccttggggcagacgtcaaag
ctagacactattccagatattcctccacctcggccaccgaaaccgcatccggctcatgac
cgatctcctgtggacacgtgtagcatcacacgcacagcctctgacactgacagtagttac
tgtatcccgacagcaggggtgcctccgtcccgtagtaataccatttccactgtggatttg
aacaaattgcgaaaagatgctagttctcaagactgctatgatattccacgaacatttcca
actgatagatctagttcactcgaaggcttccacaaccactttaaaatcaaaaatgtattg
acagtggggagtgtatcaagcgaagaactggatgaaaattatgtccccatgaatcccaac
tctcctccacgacaacattccagcagtttcacggaaccaattcaggaagcaaattatgtg
ccaatgactccggggacatttgatttttcttcatttggaatgcaagtgcctcctcccgct
catatgggcttcaggtccagcccgaagacccctcctagaaggccagttcctgttgcagac
tgtgaaccaccccccgtggatcggaacctcaagccagacagaaaaggtcaaagtcctaaa
attttaagacccaaaccccatggtttagagcgaactgattcacaaaccataggtgacttt
gctacaagaagaaaggtcaagccagcacctttagaaataaaacctttgccagaatgggaa
gaattacaagccccagtaagatctcccatcactaggagttttgctcgagactcctccagg
tttcccatgtctccccggccggattcagtgcacagcacgacttcaagcagcgactcacat
gacagtgaagagaattatgttcccatgaacccaaacctgtccagtgaagactcgaatctt
tttggcagtaatagtcttgatggaggaagcagcccaatgatcaagcccaaaggagacaaa
caagtggaatacctagatctagatttagattctgggaaatccacgccaccacgtaagcaa
aagagcagtggctcaggcagcagtgtagctgacgagagagtggactatgtcgtggttgac
caacagaagaccctggctctgaagagcacgcgtgaagcctggaccgatgggagacagtcc
acagagtctgaaacgccagccaagaatgtgaagtga

DBGET integrated database retrieval system