KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999600Help
Entry
102999600         CDS       T03086                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu03440  Homologous recombination
bacu04064  NF-kappa B signaling pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05202  Transcriptional misregulation in cancer
bacu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102999600 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102999600 (ATM)
   04068 FoxO signaling pathway
    102999600 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102999600 (ATM)
   04210 Apoptosis
    102999600 (ATM)
   04115 p53 signaling pathway
    102999600 (ATM)
   04218 Cellular senescence
    102999600 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102999600 (ATM)
   05206 MicroRNAs in cancer
    102999600 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102999600 (ATM)
   05170 Human immunodeficiency virus 1 infection
    102999600 (ATM)
   05165 Human papillomavirus infection
    102999600 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102999600 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    102999600 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bacu03032]
    102999600 (ATM)
   03400 DNA repair and recombination proteins [BR:bacu03400]
    102999600 (ATM)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102999600 (ATM)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102999600 (ATM)
DNA replication proteins [BR:bacu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102999600 (ATM)
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    102999600 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC Uso1_p115_head
Motif
Other DBs
NCBI-GeneID: 102999600
NCBI-ProteinID: XP_007173048
UniProt: A0A383ZCZ2
LinkDB All DBs
Position
Un
AA seq 3057 aa AA seqDB search
MSLALNDLLICCRQLEHDRATERRKEVEKFKRLIQDPETVQHLDQHSDSKQGKYLNWDAV
FRVLQKYIQKEMECLRTAKPNVSTSTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSNGAIYGADCSNILLKDILSVRKYWCEISQQQWTELFSVYFQLYLKPSQ
DINRVLVARIIEAVTKGCCSQTDGLNSEFLDFFSKAIQHARQEKSSAGLNHILAAFIIFL
KTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
GAYESRKWKSILYNVYDLLVNEISHIGSRGKYSSASRNIAVKENLIELMADICHQVFNED
NRSLEISQSYTTTQREFSDYNAPCKKRKIELGWEVIKDHLQKSQNDFDIVPWLQIATQLI
SKYPSSLPNCELSPLLMILHQLLPQQRHGERTPYVLRCLMEVALCQGKKSNLESSQKSDL
LKLWIKIWSITFRGISSEQIQAENFGLLGAIIQGSLVEVDREFWKSFTGSACRPSCPAVC
CLTLALTMCVVPETVKTGMEKNIYDVNRNFSLKELIMKWLLFRQLEDDFGDSAELPPILH
RNFPHLSLEKILVSLTMKNCKAAMNFFQSVPECEQHQKDTEEPSFSEVEELFLQTTFDKM
DFLTIVKEHTTEKHQSSVGFSVHQNLKQSLDRYLLGLSEQLLNNYSSETSNSETLVRCSS
LLVGVLGCYCYVGVIAEEEAYKSELFQKAKSLMQYAGESITLFKNKTNEESRIVSLRNMI
HLCTRCLHNCTKHSPNKIASGFFLRLLTSKLMNDIADICTSLVFIIKKPFDFGEVESVED
CTDENLMEMEDQSSMSLFNDYPASSVIDANESGESQITIGAMNPLAEEHLSKQDLLFLDM
LKFLCMCVTTAQTNTVSFRAADIRRKLLMLIDSSMLDLTKSLHLHMYLVLLKDLPGEEYP
LPMEDVVDLLKPLSNVCSLYRRDQDVCKTILNHVLHIVTNLCQGNMDAENTRDAQGQFLT
VIEAFWHLTKEGKCTFSVRMALVKCLKTLLEADPYSKWAILNVMGKDFPVNEVFPQFLAD
NHHQVRMLAAQSINRLFQHMKKGGPSTLLKALPLKLQQAAFENSYLKAQEGMREVSHRAE
NSESLDELCNRKAILLMMIAVVLYYSPVCEKQALFALCKSVKENGLEPHLIKKVLEKVSE
TFGYRHLEDFMASHLDYLVLQWLNLQDTEYSLSSFPFILLNYTSIENFYRSCYKVLIPHL
VIRSHFDEVKSIANQIQGDWKSLLADCFPKIIVNILPYFAYEDTGDSEMAQQRKTATKVY
DMLKDENLLGKQIDHLFISNLPEIVVELLMTLHEPATSGASQSTDPCDFSGDLDPAPNPP
HFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAVETNNVYKKHRIL
KIYHLFVSLLMNDIKSGLGGAWAFVLRDVIYTLIHYINQRPSHFMDVSLRSFSLCCDLLS
RVCHTAVTYCKDALESHLHVIVGTLIPLVDDQMEVQEQVLDLLKYLVIDNKDNENLYITI
KLLDPFPDHVVFRDLRITQQKIKYSRGPFSLLEEINHFLSVNVYDALPLTRLEGLKDLRR
QLEQHKDQMMDLMRASQDNPPDGVMVKLVVSLLQLSKMAVNHTGEREVLEAVGSCLGEVG
PIDFSTIAIQCSKDTSYTKALELFKDKELQWTFIMLTYLNNTLVEDCVKVRSAAVTCLKS
ILATKTGQSFWEIYKMTNDPMLIYLQPFRTSRKKFLEVPRFDKESPLEDLDNTSLWIPQT
ENHDIWLKTLTCAFLNSGGTKSEVLRLLKPMCEVKTDFCQTVLPYLIHDILIQDITESWR
NLLSTHIQGFFTNCFRHCSETSRSTTPANLDSESEHFFRCHLDKKSQRTMLAVVDYMRRQ
ERPSSGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYVEIYADKKNMDDQEKRSLTFEE
GSQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKILQPLTRLRTYEHE
AMWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLRGLDHENKEWCAELQELH
YQVAWRNMQWDHCISVNKGIEGTSYHESLYNALQSLRDGEFSTFYESLKYARVKEVEELC
KGSLESVYSLYPTLSRLQAIGELENIGELFSRSTTDRQPSEVYIKWWKHSQLLKDSDFSF
QEPIMALRTVILEILMEKEMENSQRECLKDILTKHLVELSVLARTFKNTQLPERAIFQIK
QYNSASCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCTENDPNLKLIYTECLR
VCGTWLAETCLENPAVIMQTYLEKAVEVAGNYDGESNDGLRNGKMKAFLSLARFSDTQYQ
RIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALHALKEDR
KRFLCKAVENYINCLLSGEGHDTWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKFLPL
MYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKPEAAR
RSRITKNAPKQSSQLDEDRTEAANKIIRTIRSRRPQMVRSVEALCDAYIILANLDATQWK
TQRKGISIPADQPIIKLKNLEDVVVPTMEIKVDPTGEYGNLVTIQSFKAEFRLAGGLNLP
KIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVP
LSQRSGVLEWCTGTVPIGEFLVNNESGAHKRYRPKDFSAYQCQKKMMDVQKKSFEEKYET
FMEICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILIN
EQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMR
NSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESELHSTLNADDQECKRNLSDID
HSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9174 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaacatgatagagct
acagaacgaaggaaagaggttgagaaatttaagcgcctgattcaggatcctgaaaccgtt
caacatttagatcagcattcagattccaaacaagggaaatatttgaattgggatgctgtt
tttagagttttacagaaatatattcagaaagaaatggaatgtctgagaacagcaaaacca
aatgtatcaacctcaacacaagccaccaggcagaaaaagatgcaagaaatcagtagctta
gtcaaatacttcatcaaatgtgcaaataaaagagcacccaggctaaaatgtcaagaactc
ttgaattatatcatggatacagtgaaagattcatctaatggtgccatttatggagctgat
tgtagcaacatattgctgaaggacattctttcagtgagaaaatactggtgtgaaatatct
cagcaacagtggacagaattgttctctgtgtacttccagctgtatcttaaaccttcacaa
gacattaatagagttttggtggctagaataattgaagctgtgaccaaaggatgctgttcg
cagactgatggattaaattccgaatttttggattttttttctaaggctattcagcatgca
agacaagaaaagagctctgcaggtctaaatcatatcttagcagcatttattatcttcctc
aagactttggctgttaactttcgaattcgagtatgtgaattaggagatgaaattcttcct
accttactttatatctggactcaacatagacttaatgattccttaaaagaagtaattatt
gagttatttcaactgcaaatttatatccatcatccaaagggagccaaaactcaagaaaaa
ggtgcctatgaatcaagaaagtggaaaagtatcttatacaatgtatatgatctgctagtt
aatgaaataagtcatataggaagcagagggaaatattcttcagcatctcgtaatattgct
gtcaaggaaaacttgattgaattgatggcagatatttgtcaccaggtttttaatgaagat
aatagatctttggagatttctcagtcttacacaaccacacaaagagaatttagtgattac
aatgcaccttgcaaaaagaggaaaatagaattaggctgggaagtaataaaggatcatctt
cagaagtcacagaatgattttgacattgtgccttggttacagattgcaactcaattaata
tcaaaatatccttcaagtttacctaactgtgagttgtcaccattactaatgatactacac
cagcttctacctcaacagcgacatggggaacgcacaccatatgtgttacgatgccttatg
gaagttgcattgtgtcaaggcaagaaatcaaacctagaaagctctcaaaagtcagattta
ctgaaactctggattaaaatttggtctattacttttcgtggtataagttctgaacaaata
caagctgaaaactttggcttacttggagccataattcaaggcagtttagttgaggttgac
agagaattctggaagtcatttactgggtcagcctgcagaccttcatgtcctgcagtatgc
tgtttgactttggcactgaccatgtgtgtagttccagaaacagtaaaaacaggaatggag
aagaatatatatgatgtaaacagaaatttttctttaaaggaattgataatgaaatggctc
ttattccgtcagttagaggatgactttggagacagtgcagagctgcctccaattcttcac
aggaattttcctcatctttccctggagaaaattcttgtgagtctcactatgaaaaactgt
aaagctgcaatgaattttttccagagtgtgccagaatgtgagcaacaccaaaaagataca
gaagaaccttcattctcagaagttgaagaactatttcttcagacaacttttgacaagatg
gattttttaaccattgtgaaagaacatactacagaaaagcaccaatccagtgtaggcttt
tctgtccaccaaaatctcaagcaatcactggatcgctatcttctgggattgtcagaacag
cttctaaataattactcatctgagacttcaaattcagaaacgcttgtccggtgttcaagt
cttttggtgggtgttctcggctgctattgttatgtgggtgtaatagctgaagaggaagca
tacaaatcagaattattccagaaagccaagtctctaatgcagtatgcaggagaaagtatc
actttgtttaaaaataagacaaatgaagaatctagaattgtttcactgagaaatatgata
catctgtgtacacgttgcttacataactgtaccaagcacagtccaaataagattgcatct
ggcttcttcttacgattattaacatcaaagctaatgaatgatattgcagatatttgtaca
agtttagtattcattatcaaaaagccatttgactttggagaagtagaatcagtggaagat
tgtactgatgaaaatctaatggagatggaggatcagtcatccatgagtctatttaatgat
taccctgctagtagtgttattgatgcaaatgaatctggagagagccaaattactattggt
gccatgaatcctttagctgaagaacatctgtcaaagcaagatctactttttttagacatg
ctcaagttcttgtgtatgtgtgtaaccactgctcagaccaatactgtgtcatttagagca
gctgatattcgaaggaaattgttaatgttaattgattctagcatgctagaccttaccaaa
tctctccatctacacatgtatctagtgcttttaaaggaccttcctggagaagaatatccc
ttgccaatggaagatgttgttgaccttctgaaaccactatctaatgtgtgttctttgtat
cgccgtgaccaagatgtttgtaaaaccattttaaaccatgtccttcacatagtgacgaac
ctatgtcaaggaaatatggatgctgagaacacaagggatgctcaaggacagtttctaaca
gtgattgaagcattttggcacttaacaaaggagggaaaatgcacattctctgtaagaatg
gcactagtaaaatgccttaaaactttgcttgaggctgatccttattcaaaatgggctatt
ctgaatgtaatgggaaaagactttcctgtaaatgaagtatttccacagtttcttgctgat
aatcatcaccaagttcgcatgttggctgcacagtcaatcaatagactatttcagcatatg
aaaaaaggaggtccttccacattattgaaagcacttcctttgaagcttcagcaagcagcg
tttgaaaattcatacttgaaagctcaggaaggaatgagagaagtgtcccacagagctgaa
aactctgaaagtttggatgagctttgtaatagaaaggccattttactgatgatgatagct
gtggtgttatactatagccctgtatgtgaaaaacaggctttattcgccctatgcaagtct
gtgaaagagaatggattagagcctcacctcattaaaaaggttttagagaaagtttctgaa
acttttggatatagacatttagaagacttcatggcttctcatttggattatctggtattg
caatggctaaatcttcaagatactgaatacagcttatcttcttttccttttattttatta
aactacacaagcattgaaaatttctacaggtcttgttataaagttttgattccacatctg
gtgattagaagtcattttgatgaggtaaagtccattgctaaccagattcaaggggattgg
aaaagtcttctggcagactgctttccaaagattattgtaaatattcttccatactttgct
tatgaggatacaggagacagtgagatggcacaacaaagaaagactgctaccaaagtctat
gatatgcttaaagatgaaaacttattaggaaaacagattgatcatttattcattagtaat
ttaccagagattgtggtggagttattaatgacgttacatgaaccagcaacttctggtgcc
agccaaagcactgacccctgtgacttttcaggggatttggatcctgctcctaatccacct
cattttccatcacatgtgattaaagcgacatttgcctatatcagcaattgccacaaaacc
aagcttaaaagcattttagaaattctttccaaaagccctgattcctatcagaaaattctt
ctagccatatgtgagcaagcagttgagacaaataatgtttataaaaaacatagaattctt
aaaatatatcacctgtttgttagtttattaatgaacgatataaagagtggcttaggagga
gcttgggcctttgttcttcgagatgttatttatactttgattcactatatcaaccaaagg
ccttctcatttcatggatgtgtcattacgtagcttctccctttgttgtgacctgttaagc
cgggtttgccacacagcagtaacttactgtaaggatgctttagaaagtcatcttcatgtt
attgttggtacacttataccccttgtggatgatcagatggaggttcaggaacaggtattg
gacttgttgaaatacttagtgattgataacaaggataatgaaaatctctatatcacgatt
aaacttttagatccttttcctgaccatgttgtctttagggatttgcgtattactcagcag
aaaatcaaatacagtagaggacccttttcacttttggaggaaattaaccattttctctca
gtaaatgtttatgatgcacttccattgacaaggcttgaaggattgaaggatcttcgaaga
caactagagcaacataaagatcagatgatggatcttatgagagcatctcaggataaccct
ccagatggtgtaatggtgaagctagttgtcagcttgttgcagttatccaagatggcagta
aaccacactggtgaaagagaagttttagaggctgttggaagctgcttgggagaagtgggt
cctatagatttctctacaatagccatacaatgtagtaaagatacatcttataccaaggcc
cttgagttatttaaagataaagaacttcagtggaccttcataatgctgacctacctgaat
aatacactggtggaagattgtgtcaaagtgcgatcagcagctgttacctgtttgaaaagc
attttagccacaaaaactggacaaagtttctgggagatttataagatgacaaatgatccc
atgctgatctatctacagccttttcgaacatcaagaaaaaagtttttagaagtacctaga
tttgacaaagaaagccctttagaagacttggataatacaagcctgtggattcctcaaact
gaaaatcatgacatttggttaaagacactgacttgtgcttttttgaatagtggaggcaca
aaaagtgaagttcttcggttattaaagccaatgtgtgaggtgaaaactgacttttgtcag
actgtgcttccatacttgattcatgacattttaatccaagatataactgaatcatggaga
aatctgctttctacacacattcagggatttttcactaactgtttcagacactgctcagaa
acaagccgatccacaactcctgcaaatttggattcagagtcagagcactttttccgatgc
catttggataaaaaatcacaaagaacaatgcttgctgttgtggactacatgaggagacaa
gagagaccttcttcaggaacagtttttgatgatgctttctggctggaattgaattatcta
gaggttgccaaggtagctcagtcttgtgctgctcattttacagcattgctctatgtagaa
atctatgcagataagaagaacatggacgatcaagagaaaagaagtcttacgtttgaagaa
ggaagccagagtacaactatttccagtttgagtgaaaaaagtaaggaagaaactggaata
agtttacaggatctgctcttagaaatctacagaagtataggagagccagatagtctttac
ggttgtggtggagggaaaatattacaaccccttactagactacgaacatatgaacatgaa
gcaatgtgggggaaagccctagtgacatatgacctcgagacagcaatctcctcctcaact
cgccaggcaggaataattcaggccttgcagaatttgggactctgccatattctttccgtc
tatttaaggggattagatcatgaaaataaagagtggtgtgctgaactacaggaacttcat
taccaagtagcgtggaggaatatgcagtgggaccactgcatttctgtcaacaaaggaata
gaaggaaccagttaccatgaatcattgtataatgctctgcagtctctaagagatggggaa
ttctccactttttatgaaagtctcaaatatgccagagttaaagaagtggaagagttgtgt
aagggcagtcttgagtctgtgtattccctctaccctacacttagcagattgcaggccatc
ggagagctcgaaaacattggggagcttttctcaagatcaacaacagataggcagccctct
gaagtatacattaagtggtggaaacattcccagcttctcaaagacagtgattttagtttt
caggagcctataatggctctacgcacagtcattttggagatcttgatggaaaaggaaatg
gaaaactcgcaaagagagtgtcttaaggacattctcaccaagcatcttgtagaactctct
gtattagcccgaactttcaagaacactcagctccctgaaagggcaatatttcaaattaaa
cagtataattcagctagttgtggagtctctgagtggcagctggaggaagcacaagtattc
tgggcgaaaaaggaacagagtcttgccctgagtattctcaagcaaatgatcaagaagctg
gatgccagttgtacagagaatgatcccaacctaaaacttatatacacagaatgtctgagg
gtctgtggcacctggttagcagaaacttgcttagaaaatcctgcagtcatcatgcagacc
tatctagaaaaggcagtggaagttgctggaaattatgatggagaaagcaatgatgggctc
agaaatggaaaaatgaaggcatttctctcattagcacggttctcagatactcagtaccaa
agaattgaaaactacatgaaatcgtcagagtttgaaaacaagcaagccctcctgaaaaga
gctaaagaggaagttggccttcttagggaacataaaattcagaccaacagatacacagta
aaggttcagcgagagctggagttggatgaatgtgcactccatgcattgaaagaagatcgt
aaacgcttcttatgtaaggcagttgaaaattacatcaattgcttattaagtggagaaggg
catgatacgtggatattccgtctttgttccctctggcttgaaaattctggagtttctgaa
gtcaatggcatgatgaagagagatggaatgaagattccatcatataaatttttgcctctt
atgtaccaattggctgctagaatggggaccaagatgatgggaggcctaggatttcatgaa
gtcctcaataatctcatctctagaatttcaatggatcaccctcatcatactttgtttatt
atactggctttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggcagcaaga
aggagcagaataactaaaaatgcacctaaacaaagctctcagcttgatgaggatcgaacc
gaggctgcaaacaaaataatacgtactatcagaagcaggagacctcagatggtcagaagt
gttgaggcactttgtgatgcttacattatactagcaaatttagatgccactcagtggaag
actcagagaaaaggcataagtattccggcagaccagcccattatcaaacttaaaaattta
gaagatgttgttgttcctactatggaaattaaggtggaccccacaggggaatatggaaat
ctggtgactatacagtcatttaaagcagaatttcgtttagcaggaggtttaaatttacca
aaaataatagattgtttgggttctgatggcaaggaaaggagacagcttgtcaagggccgt
gatgacctgagacaagatgctgtcatgcagcaggttttccagatgtgtaatacattgctg
cagagaaatactgaaaccaggaagaggaagttgactatctgcacatataaggtggttccc
ctttctcagcgaagtggtgttcttgaatggtgcacaggaactgtccctattggtgaattt
cttgttaacaatgagagtggcgctcataaaagatacaggccaaaggatttcagtgcctat
cagtgccaaaagaaaatgatggatgtacaaaaaaagtcttttgaagagaaatatgaaacc
ttcatggagatttgccaaaattttcaaccagttttccgttacttctgcatggaaaaattc
ttggatccagctgtttggtttgagaaacgattggcttatactcggagtgttgctacttct
tctattgttggttacatacttggacttggtgatagacatgtacagaatatcttgataaat
gagcagtcagcagaacttgtacatatagatttaggagttgcttttgaacagggtaaaatc
cttcctactcctgaaacagttccctttagactcaccagagatattgtggatgggatgggc
attactggtgtagaaggtgtcttcagaagatgctgtgagaaaaccatggaggttatgaga
aactctcaggaaaccctgttaaccattgtagaggtcctcctgtatgatcctctctttgac
tggacaatgaatcctttgaaagctctgtatttacagcagaggccagaggatgaaagtgag
ctccattccactctaaatgcagatgaccaggaatgcaaacgaaatctcagtgatattgac
cacagtttcaacaaagtagctgaacgtgtcttgatgagactgcaagagaaactaaaagga
gtggaggaaggaaccgtgctcagtgttggtgggcaggtgaatttgctcatacaacaagcc
atggaccccaaaaatctcagccgacttttcccaggctggaaagcttgggtgtga

DBGET integrated database retrieval system