KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999710Help
Entry
102999710         CDS       T03086                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102999710 (SUV39H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    102999710 (SUV39H2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102999710 (SUV39H2)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102999710 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102999710 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 102999710
NCBI-ProteinID: XP_007196499
LinkDB All DBs
Position
Un
AA seq 349 aa AA seqDB search
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITLKENHRALK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCXXXXXXXXXAEAGFLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPN
RIVQKGTQYSLCIFRTSNGCGWGVKTLVKIRRRSFVMEYVGEVITSEEAERRGQLYDNKG
ITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRT
INAGEELTFDYQMKGSGDISSDSIDHSPAKKRARTVCKCGAVTCRGYLN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacct
ttgcaaaatctcaagtgcccattactgcttcagcagttctctaatgacaagcataattat
ttatctcaggtaaagaaaggcaaagcaataactctaaaagaaaatcacagagctttgaaa
cctgccattgctgaatacattgtaaagaaggctaaacaaaggatagctctgcagagatgg
caggacgaactcaacagaaggaagaatcacaaaggaatgatttttgttgaaaatactgtg
gacttagagggccccccttcagacttctactacattaatgaatacaaaccagctcctgga
atcagcttagtaaatgaagccacctttggttgttcatgcnnnnnnnnnnnnnnnnnnnnn
nnnnnngctgaagctggatttcttttggcttataataaaaatcaacaaattaaaatccca
cctggcacccccatttacgaatgcaactcaaggtgtcagtgtggacccgattgtcccaac
aggattgtccaaaaaggcacgcagtattcactttgcatctttcggaccagcaatggctgc
ggctggggcgtaaagacccttgtgaagattaggagaaggagctttgtcatggagtatgtc
ggagaggtaatcacaagtgaagaagctgaaagacgggggcagttatatgacaacaaagga
atcacatatctctttgatctggattatgaatctgatgaattcacagtggatgcagctcga
tatggaaatgtgtctcattttgtgaaccacagttgtgacccgaatcttcaggtgttcaac
gttttcattgataacctcgacacccgtcttccccgaatagcattattttccacgagaact
ataaatgctggagaagagctcacttttgattatcaaatgaaaggttctggagatatatct
tcagattctattgaccacagcccagccaaaaagagggccagaactgtgtgcaaatgtgga
gctgtgacttgcagaggttacctcaactga

DBGET integrated database retrieval system