KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999779
Entry
102999779         CDS       T03086                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box O3
  KO
K09408  forkhead box protein O3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04062  Chemokine signaling pathway
bacu04068  FoxO signaling pathway
bacu04137  Mitophagy - animal
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04722  Neurotrophin signaling pathway
bacu04917  Prolactin signaling pathway
bacu05213  Endometrial cancer
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102999779 (FOXO3)
   04151 PI3K-Akt signaling pathway
    102999779 (FOXO3)
   04152 AMPK signaling pathway
    102999779 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102999779 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    102999779 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102999779 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102999779 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102999779 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    102999779 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    102999779 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    102999779 (FOXO3)
   05223 Non-small cell lung cancer
    102999779 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102999779 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    102999779 (FOXO3)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    102999779 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 102999779
NCBI-ProteinID: XP_007191149
LinkDB
Position
Un
AA seq 571 aa
PGGQDPGSGPAPAVGALSGGTQTPLQPQQTLPPPQPGAAGGSGQPRKCSSRRNAWGNLSY
ADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMR
VQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESAD
DSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAP
LSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLADNLMDDLLDNIALPASQPS
PPGGLMQRSSSFPYTTKGSGLGSPTSSFSSTVFGPSSLNSLRQSPMQTIQENKPATFSSM
SHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRSDPMMSFAAQ
PNQGSLVNQNLLHHQHQTQGALGGSRALSSSVSNMGLSDSSSLGSAKHQQQSPVSQSMQT
LSDSLSGSSLYSTSAHLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNF
DSLISTQNVVGLNVGSFTGAKQASSQSWVPG
NT seq 1716 nt   +upstreamnt  +downstreamnt
cccggagggcaggaccccgggtccgggccagcccccgcggtgggcgcgctgagcgggggg
acgcagacgccgctgcagcctcagcagacactgccaccgccgcagccgggggcggctggg
ggctccgggcagccgaggaaatgttcatcgcggcggaacgcctgggggaacttgtcatac
gccgacctgatcactcgcgccatcgagagctccccggacaaacggctcactctgtcccag
atctacgagtggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaacagc
tctgccggctggaagaactctatccggcacaacctgtcgctgcacagccggttcatgagg
gttcagaatgaggggaccggcaagagctcatggtggatcatcaaccccgacggggggaag
agtgggaaggcgccccggcggcgggccgtctccatggacaacagcaacaagtacaccaag
agccggggccgtgcagccaagaagaaggcagccctgcagaccgcccccgagtcagcagac
gacagtccctcccagctctccaagtggcccggcagccccacgtctcgcagcagcgatgag
ctggacgcgtggaccgacttccgctcacgcaccaattccaacgccagcacagtcagcggc
cgcctgtcccctatcctggctagcacggagttggacgacgttcaggatgatgacgcgccg
ctctcccccatgctctacagcagctcagccagcctgtccccctccgtcagcaagccgtgc
accgtggagctgccccggctgaccgacatggcgggcaccatgaatctgaacgacgggctg
gccgacaacctcatggacgacctgctggacaacatcgcgctccctgcgtcccagccgtcg
ccccccggggggctcatgcagcgcagctccagcttcccatacaccaccaagggctccggc
ctgggctcccccaccagctccttcagcagcacggtgttcggcccctcgtctctgaactcc
ctgcgtcagtctcccatgcagaccatccaagagaacaagccagccaccttctcttccatg
tcgcactacggcaaccagacgctccaggacctgctcacgtcggactcactcagccacagc
gatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtccgcc
cagaactcccgccggaacgtgatgcttcgcagtgatccaatgatgtcctttgccgcccag
cctaaccagggaagtttggtcaatcagaacttgctccaccaccagcaccaaacccagggc
gctctcggtggcagccgtgccttgtcaagttccgtcagcaacatgggcttgagcgattcc
agcagcctcgggtcagccaaacaccagcagcagtctcctgtcagccagtctatgcaaacc
ctctcggactctctctcaggctcctccttgtactcaactagtgcacaccttcccgtcatg
ggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaatgt
gacatggagtccattatccgtagcgaactcatggatgctgatgggttggattttaacttt
gattccctcatctccacacagaacgttgttggtttgaatgtggggagcttcactggtgct
aagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system