KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999836
Entry
102999836         CDS       T03086                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04217  Necroptosis
bacu04650  Natural killer cell mediated cytotoxicity
bacu04722  Neurotrophin signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04940  Type I diabetes mellitus
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05142  Chagas disease
bacu05143  African trypanosomiasis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05320  Autoimmune thyroid disease
bacu05330  Allograft rejection
bacu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999836 (FASLG)
   04014 Ras signaling pathway
    102999836 (FASLG)
   04068 FoxO signaling pathway
    102999836 (FASLG)
   04151 PI3K-Akt signaling pathway
    102999836 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102999836 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102999836 (FASLG)
   04217 Necroptosis
    102999836 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102999836 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102999836 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999836 (FASLG)
   05205 Proteoglycans in cancer
    102999836 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102999836 (FASLG)
   05330 Allograft rejection
    102999836 (FASLG)
   05332 Graft-versus-host disease
    102999836 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102999836 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102999836 (FASLG)
   04932 Non-alcoholic fatty liver disease
    102999836 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102999836 (FASLG)
   05161 Hepatitis B
    102999836 (FASLG)
   05160 Hepatitis C
    102999836 (FASLG)
   05164 Influenza A
    102999836 (FASLG)
   05162 Measles
    102999836 (FASLG)
   05168 Herpes simplex virus 1 infection
    102999836 (FASLG)
   05163 Human cytomegalovirus infection
    102999836 (FASLG)
   05165 Human papillomavirus infection
    102999836 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102999836 (FASLG)
   05143 African trypanosomiasis
    102999836 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102999836 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    102999836 (FASLG)
   04052 Cytokines and growth factors [BR:bacu04052]
    102999836 (FASLG)
   04090 CD molecules [BR:bacu04090]
    102999836 (FASLG)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102999836 (FASLG)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Tumor necrosis fators
   102999836 (FASLG)
CD molecules [BR:bacu04090]
 Proteins
  102999836 (FASLG)
SSDB
Motif
Pfam: TNF RskA
Other DBs
NCBI-GeneID: 102999836
NCBI-ProteinID: XP_007165396
UniProt: A0A383YRN2
LinkDB
Position
Un
AA seq 262 aa
MQRPLNYPYPQIFWVDSSASSPWASPGSVFPCPSSVPGRPGQRRPPPLPPPLKKRRDHNT
GPCLLVMFFMVLVALLGLGMGLFQLFHLQKELAELRESTSQRHTESSLEKQIGHPNPPSE
KKELRKAAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGSLVINETGLYFVYSKVYFRG
QSCNNQPLNHKVYTRNFRYPQDLVLMEGKMMNYCTTGQMWARSSYLGAVFNLTNADHLYV
NVSELSLVNFEESKTFFGLYKL
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcaacggcccctgaattacccgtacccccagattttctgggtggacagcagtgccagc
tctccctgggcctctccagggtcagttttcccctgtccgtcctctgtgccaggaaggccc
gggcaaaggaggccaccgccactaccaccacctctgaagaagaggagggaccacaacaca
ggcccgtgtctcctcgtgatgtttttcatggttctggtggccctgcttggattggggatg
ggactatttcagctcttccatctgcagaaggaactggccgaactcagagagtccaccagc
caaaggcatacagaatcatctttggagaagcaaataggtcaccccaatccaccctctgag
aaaaaggagctgagaaaggcagcccatttaacaggcaagcccaactcaagatccatccct
ctggaatgggaagacacttatggaattgccctggtctctggggtgaagtataagaagggc
agccttgtgatcaatgaaactgggctgtattttgtgtattccaaagtgtacttccggggt
cagtcctgcaacaaccagcccctgaaccacaaggtctacacgaggaactttaggtacccc
caggacctggtgctcatggaggggaagatgatgaactactgcactactggccagatgtgg
gcccgcagcagctacctgggggctgtgttcaatctcaccaatgctgaccatttatatgtc
aatgtatctgagctctctctggtcaattttgaggaatctaagacattttttggcttatat
aagctctaa

DBGET integrated database retrieval system