KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999845
Entry
102999845         CDS       T03086                                 

Definition
(RefSeq) putative Bcl-2 homologous antagonist/killer 2-like
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04141  Protein processing in endoplasmic reticulum
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05160  Hepatitis C
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102999845
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102999845
   04215 Apoptosis - multiple species
    102999845
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999845
   05202 Transcriptional misregulation in cancer
    102999845
   05206 MicroRNAs in cancer
    102999845
   05203 Viral carcinogenesis
    102999845
  09162 Cancer: specific types
   05210 Colorectal cancer
    102999845
   05212 Pancreatic cancer
    102999845
   05225 Hepatocellular carcinoma
    102999845
   05226 Gastric cancer
    102999845
   05214 Glioma
    102999845
   05216 Thyroid cancer
    102999845
   05220 Chronic myeloid leukemia
    102999845
   05217 Basal cell carcinoma
    102999845
   05218 Melanoma
    102999845
   05213 Endometrial cancer
    102999845
   05224 Breast cancer
    102999845
   05222 Small cell lung cancer
    102999845
   05223 Non-small cell lung cancer
    102999845
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102999845
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102999845
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102999845
   05160 Hepatitis C
    102999845
   05164 Influenza A
    102999845
   05162 Measles
    102999845
   05168 Herpes simplex virus 1 infection
    102999845
   05163 Human cytomegalovirus infection
    102999845
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999845
   05169 Epstein-Barr virus infection
    102999845
   05165 Human papillomavirus infection
    102999845
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102999845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bacu03029]
    102999845
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacu02000]
    102999845
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102999845
Transporters [BR:bacu02000]
 Other transporters
  Pores ion channels [TC:1]
   102999845
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 102999845
NCBI-ProteinID: XP_007186943
UniProt: A0A384AHW7
LinkDB
Position
Un
AA seq 211 aa
MASGQGPGPPRQGCEEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEM
VTLSLEPSSTMGQVGRQLAIIGDDINRRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
SSINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LDLGNGPIWNVLIVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcatccggacaaggcccaggtcctcccaggcaggggtgcgaagaacctgacccctcc
tccacttcggaggagcaggtagcccgggacacggaggaggttttccgcagctacgtcttt
taccgccatcagcaggagcaggaggccgagggggcggccgcgcccacagacccagaaatg
gtcaccttgtccctagaacctagcagcaccatggggcaggtgggtcgccagctggccatc
atcggggatgacatcaaccggcgctacgactccgagttccaggccatgttgcagcacctg
cagccaacagcagagaacgcctacgagtatttcaccaagattgcctcaagcctgtttgag
agcagcatcaactggggccgagtggtggctctgctgggctttggctaccgcctggccctc
cacgtctaccagcgcggcctgactggcttcctgggccaggtgacccgcttcgtggccgac
ttcatgttgcatcactgcattgcccggtggatcgcacagaggggtggctgggtggcagcc
ctggacttgggaaacggccccatctggaatgtgctgatagttctggctgtggttttgttg
ggccagtttgtggtacgaagatttttcaagtcatga

DBGET integrated database retrieval system