KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000011
Entry
103000011         CDS       T03086                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04020  Calcium signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04114  Oocyte meiosis
bacu04140  Autophagy - animal
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04310  Wnt signaling pathway
bacu04340  Hedgehog signaling pathway
bacu04371  Apelin signaling pathway
bacu04530  Tight junction
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04727  GABAergic synapse
bacu04728  Dopaminergic synapse
bacu04740  Olfactory transduction
bacu04742  Taste transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04910  Insulin signaling pathway
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04962  Vasopressin-regulated water reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04976  Bile secretion
bacu05012  Parkinson disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05032  Morphine addiction
bacu05034  Alcoholism
bacu05146  Amoebiasis
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103000011 (PRKACA)
   04014 Ras signaling pathway
    103000011 (PRKACA)
   04310 Wnt signaling pathway
    103000011 (PRKACA)
   04340 Hedgehog signaling pathway
    103000011 (PRKACA)
   04371 Apelin signaling pathway
    103000011 (PRKACA)
   04020 Calcium signaling pathway
    103000011 (PRKACA)
   04024 cAMP signaling pathway
    103000011 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103000011 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103000011 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103000011 (PRKACA)
   04540 Gap junction
    103000011 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103000011 (PRKACA)
   04062 Chemokine signaling pathway
    103000011 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    103000011 (PRKACA)
   04910 Insulin signaling pathway
    103000011 (PRKACA)
   04922 Glucagon signaling pathway
    103000011 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    103000011 (PRKACA)
   04912 GnRH signaling pathway
    103000011 (PRKACA)
   04913 Ovarian steroidogenesis
    103000011 (PRKACA)
   04915 Estrogen signaling pathway
    103000011 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    103000011 (PRKACA)
   04921 Oxytocin signaling pathway
    103000011 (PRKACA)
   04926 Relaxin signaling pathway
    103000011 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    103000011 (PRKACA)
   04918 Thyroid hormone synthesis
    103000011 (PRKACA)
   04919 Thyroid hormone signaling pathway
    103000011 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    103000011 (PRKACA)
   04916 Melanogenesis
    103000011 (PRKACA)
   04924 Renin secretion
    103000011 (PRKACA)
   04925 Aldosterone synthesis and secretion
    103000011 (PRKACA)
   04927 Cortisol synthesis and secretion
    103000011 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103000011 (PRKACA)
   04270 Vascular smooth muscle contraction
    103000011 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    103000011 (PRKACA)
   04971 Gastric acid secretion
    103000011 (PRKACA)
   04976 Bile secretion
    103000011 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103000011 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103000011 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    103000011 (PRKACA)
   04727 GABAergic synapse
    103000011 (PRKACA)
   04725 Cholinergic synapse
    103000011 (PRKACA)
   04728 Dopaminergic synapse
    103000011 (PRKACA)
   04726 Serotonergic synapse
    103000011 (PRKACA)
   04720 Long-term potentiation
    103000011 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    103000011 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    103000011 (PRKACA)
   04742 Taste transduction
    103000011 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    103000011 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    103000011 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    103000011 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103000011 (PRKACA)
   04714 Thermogenesis
    103000011 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103000011 (PRKACA)
   05205 Proteoglycans in cancer
    103000011 (PRKACA)
   05203 Viral carcinogenesis
    103000011 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103000011 (PRKACA)
   05020 Prion disease
    103000011 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    103000011 (PRKACA)
   05031 Amphetamine addiction
    103000011 (PRKACA)
   05032 Morphine addiction
    103000011 (PRKACA)
   05034 Alcoholism
    103000011 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103000011 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103000011 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103000011 (PRKACA)
   05163 Human cytomegalovirus infection
    103000011 (PRKACA)
   05165 Human papillomavirus infection
    103000011 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103000011 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103000011 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103000011 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bacu03019]
    103000011 (PRKACA)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103000011 (PRKACA)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103000011 (PRKACA)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  PKA family
   103000011 (PRKACA)
Messenger RNA biogenesis [BR:bacu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103000011 (PRKACA)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103000011 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH
Other DBs
NCBI-GeneID: 103000011
NCBI-ProteinID: XP_007182125
UniProt: A0A384A439
LinkDB
Position
Un
AA seq 293 aa
MLVKHKESGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLY
MIMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQ
GYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWF
ATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 882 nt   +upstreamnt  +downstreamnt
atgctggtgaagcacaaggaatccgggaaccactttgccatgaagatcctcgacaaacag
aaggtggtaaagctgaaacagattgagcacaccctgaacgaaaagcgcatcctgcaagcg
gtcaactttccgttccttgtcaaactcgagttctccttcaaggacaactcaaatttatac
atgatcatggagtacgtgcctggtggggagatgttctcacacctgcggcggatcgggagg
ttcagtgagccccatgcccgcttctacgcagcccagattgtcctgaccttcgagtacctg
cactcgctcgatctcatctaccgggacctgaagccggagaacctcctcatcgaccagcag
ggctacattcaggtgacagacttcggtttcgccaagcgtgtgaaaggccgcacctggacc
ttgtgcggcacccccgagtacctggcccccgagatcatcctgagtaaaggctacaacaaa
gctgtggactggtgggccctgggggttctcatctatgagatggccgctggctacccgccc
ttcttcgctgaccagcccatccagatctatgagaagattgtctctgggaaggtgcggttc
ccgtcccacttcagctccgacctgaaggatctgctgcggaacctcctgcaggtggacctc
accaaacgctttgggaacctcaagaacggggtcaatgatatcaagaaccacaagtggttt
gccacgactgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaag
tttaaaggccctggggacacgagtaactttgatgactatgaggaggaagagatccgagtc
tccatcaatgagaagtgtggcaaggagttttctgagttttag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008319
Entry
103008319         CDS       T03086                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04020  Calcium signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04114  Oocyte meiosis
bacu04140  Autophagy - animal
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04310  Wnt signaling pathway
bacu04340  Hedgehog signaling pathway
bacu04371  Apelin signaling pathway
bacu04530  Tight junction
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04727  GABAergic synapse
bacu04728  Dopaminergic synapse
bacu04740  Olfactory transduction
bacu04742  Taste transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04910  Insulin signaling pathway
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04962  Vasopressin-regulated water reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04976  Bile secretion
bacu05012  Parkinson disease
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05032  Morphine addiction
bacu05034  Alcoholism
bacu05146  Amoebiasis
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103008319 (PRKACB)
   04014 Ras signaling pathway
    103008319 (PRKACB)
   04310 Wnt signaling pathway
    103008319 (PRKACB)
   04340 Hedgehog signaling pathway
    103008319 (PRKACB)
   04371 Apelin signaling pathway
    103008319 (PRKACB)
   04020 Calcium signaling pathway
    103008319 (PRKACB)
   04024 cAMP signaling pathway
    103008319 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103008319 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103008319 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103008319 (PRKACB)
   04540 Gap junction
    103008319 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103008319 (PRKACB)
   04062 Chemokine signaling pathway
    103008319 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    103008319 (PRKACB)
   04910 Insulin signaling pathway
    103008319 (PRKACB)
   04922 Glucagon signaling pathway
    103008319 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    103008319 (PRKACB)
   04912 GnRH signaling pathway
    103008319 (PRKACB)
   04913 Ovarian steroidogenesis
    103008319 (PRKACB)
   04915 Estrogen signaling pathway
    103008319 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    103008319 (PRKACB)
   04921 Oxytocin signaling pathway
    103008319 (PRKACB)
   04926 Relaxin signaling pathway
    103008319 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    103008319 (PRKACB)
   04918 Thyroid hormone synthesis
    103008319 (PRKACB)
   04919 Thyroid hormone signaling pathway
    103008319 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    103008319 (PRKACB)
   04916 Melanogenesis
    103008319 (PRKACB)
   04924 Renin secretion
    103008319 (PRKACB)
   04925 Aldosterone synthesis and secretion
    103008319 (PRKACB)
   04927 Cortisol synthesis and secretion
    103008319 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103008319 (PRKACB)
   04270 Vascular smooth muscle contraction
    103008319 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    103008319 (PRKACB)
   04971 Gastric acid secretion
    103008319 (PRKACB)
   04976 Bile secretion
    103008319 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103008319 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103008319 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    103008319 (PRKACB)
   04727 GABAergic synapse
    103008319 (PRKACB)
   04725 Cholinergic synapse
    103008319 (PRKACB)
   04728 Dopaminergic synapse
    103008319 (PRKACB)
   04726 Serotonergic synapse
    103008319 (PRKACB)
   04720 Long-term potentiation
    103008319 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    103008319 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    103008319 (PRKACB)
   04742 Taste transduction
    103008319 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    103008319 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    103008319 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    103008319 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103008319 (PRKACB)
   04714 Thermogenesis
    103008319 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008319 (PRKACB)
   05205 Proteoglycans in cancer
    103008319 (PRKACB)
   05203 Viral carcinogenesis
    103008319 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103008319 (PRKACB)
   05020 Prion disease
    103008319 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    103008319 (PRKACB)
   05031 Amphetamine addiction
    103008319 (PRKACB)
   05032 Morphine addiction
    103008319 (PRKACB)
   05034 Alcoholism
    103008319 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103008319 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103008319 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103008319 (PRKACB)
   05163 Human cytomegalovirus infection
    103008319 (PRKACB)
   05165 Human papillomavirus infection
    103008319 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103008319 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103008319 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103008319 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bacu03019]
    103008319 (PRKACB)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103008319 (PRKACB)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103008319 (PRKACB)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  PKA family
   103008319 (PRKACB)
Messenger RNA biogenesis [BR:bacu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103008319 (PRKACB)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103008319 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103008319
NCBI-ProteinID: XP_007173069
UniProt: A0A383ZDW7
LinkDB
Position
Un
AA seq 397 aa
MAAYRELPCNQYTGTTALQKLEGFASRLFHRHSKGTAHDQKTTLENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttacagagaactaccctgtaatcagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacactccaaaggtactgcacatgatcag
aaaacaactctggaaaatgacagccttcatttctctgaacatactgccttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttttaaaaaaatgggaaaatcct
gctccgaataatgccgggctggaagattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacagtattatgcaatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaaaga
atattacaggcggtgaattttccttttcttgttcgactggagtattcttttaaggataat
tctaatttatacatggttatggaatatgtccctggtggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaaggttatatccaggtcacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatacttggctccagaaataattctcagcaag
ggctacaataaggcagtggattggtgggcattaggagtgttaatctatgaaatggcagct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttccgga
aaggttcgattcccttctcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggacctgacgaagcggtttggaaatctaaagaatggtgtgagtgatataaaaact
cacaagtggtttgccacaactgattggattgctatttaccagaggaaggttgaagctcca
ttcataccaaagttcagaggctctggagataccagcaattttgatgactatgaagaagaa
gatatccgtgtctctataacagaaaaatgtggaaaagaattttgtgaattttag

DBGET integrated database retrieval system