KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000044
Entry
103000044         CDS       T03086                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04024  cAMP signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04310  Wnt signaling pathway
bacu04330  Notch signaling pathway
bacu04350  TGF-beta signaling pathway
bacu04520  Adherens junction
bacu04630  JAK-STAT signaling pathway
bacu04720  Long-term potentiation
bacu04916  Melanogenesis
bacu04919  Thyroid hormone signaling pathway
bacu04922  Glucagon signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05016  Huntington disease
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05206  MicroRNAs in cancer
bacu05211  Renal cell carcinoma
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103000044 (EP300)
   04330 Notch signaling pathway
    103000044 (EP300)
   04350 TGF-beta signaling pathway
    103000044 (EP300)
   04630 JAK-STAT signaling pathway
    103000044 (EP300)
   04066 HIF-1 signaling pathway
    103000044 (EP300)
   04068 FoxO signaling pathway
    103000044 (EP300)
   04024 cAMP signaling pathway
    103000044 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103000044 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103000044 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103000044 (EP300)
   04935 Growth hormone synthesis, secretion and action
    103000044 (EP300)
   04919 Thyroid hormone signaling pathway
    103000044 (EP300)
   04916 Melanogenesis
    103000044 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    103000044 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103000044 (EP300)
   05206 MicroRNAs in cancer
    103000044 (EP300)
   05203 Viral carcinogenesis
    103000044 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    103000044 (EP300)
   05215 Prostate cancer
    103000044 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103000044 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103000044 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103000044 (EP300)
   05161 Hepatitis B
    103000044 (EP300)
   05164 Influenza A
    103000044 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103000044 (EP300)
   05165 Human papillomavirus infection
    103000044 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103000044 (EP300)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103000044 (EP300)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103000044 (EP300)
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103000044 (EP300)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    103000044 (EP300)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103000044 (EP300)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    103000044 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 103000044
NCBI-ProteinID: XP_007189356
LinkDB
Position
Un
AA seq 2408 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVSGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGMMNSPVNQPAMGMNTGMNAGMNPGMLT
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQTPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSAPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMAPVSMNPGPSMGQPQPGMTANGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTN
MPLAPSGSQAPVSQAQMSSSSCPVNSPIMPPGSQGSHMHCPPLPQPALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPPTQLPPQAQP
SLPAAPSVDQAQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQASNPPSTSS
TEVNSQAIPEKQPSQEVKMEAKMEVDAPEPADTQPEDIPETKAEDCKAEPTETEERGAEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRAGVVGQQQGLPSPTPATPTTPT
GQQPTTPQTPYLPRTKAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRA
AETQRQMAHVQSFQRPIQHQMPQMTPMAPMGMNAPPMARGPGGHLEPGVEPTGLQQPPPW
AQGGLPQPQHLQPGMPRPAMMSVSQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLL
RTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANANPQPLPGQPGVPQGQPGLQP
PAMPGQQGVHSSPAMPNLNPMQAGVQRAGLPQQQAPQQQLPPPMGGMSPQAQQMSMNHST
MPAQFRDILRRQQMMQQQQQQQQQQQQGAGPGVGPGLASHSQFQPPQGLGYPAPQPPPPP
RMQQHMQHLQQGSGGQLGPLPQALGAEAGAGLQAYQQRLLQQQMGSPAQPNPMSPQQHML
PSQAQSPHLPGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSS
PHPGLVAAQGNPMEQGHFASPDQNSMLSQLTSNPGMANLHGASATDLGLGADNADLNSDL
SQSTLDIH
NT seq 7227 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggttctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcaacttcagacgagccttggcatggtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctgcgttctggtagttcccctaacctcaacatgggggttagtggccca
ggccaaggcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcccacaccatctgcaacaggtatgatgaacagtccagtaaat
caacctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgact
gcaggcaatggacaagggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaacttaatg
actgagccactgcagcaaggctctccccagatgggaggacaaacaggattgagagggccc
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagattggagccagtggccttggtctccagattccgacaaagtctgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggccagcagcagaccccgcaggtccagcagccaggcctggtgactccggtg
gcccaagggatgggttctggagcccacacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttgcacgctcacaagtgccagcggcgagagcaggccaatggg
gaagtgaggcagtgcaaccttccccactgtcgtacaatgaagaacgtccttaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtctaccccttaaaaat
gctggagataagagaaatcaacagtcaattctgactggagcaccagttggacttggaaat
actagctctctaggggtgggtcaacagtctgctcccagcctaagcactgttagtcagatt
gatcccagctctatagaaagggcttatgcagcccttggactaccctatcaagtaaatcag
atgccaacacagccccaggtgcaagcaaagaaccagcagaaccagcagtctggacagtct
ccccaggggatgcggcctatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacgtcgaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctgggccctatgccaacagca
gctcaaccatccagtactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacggatggaaaacctggttgcatatgcccggaaagtggaaggggacatg
tatgaatctgcgaacaatcgagcggaatactaccacctgctagctgagaagatctataag
atccagaaggaactagaagagaaacgaaggactagactacaaaaacagaacatgctgcca
agcgccgcaagcatggcgccggtttccatgaacccggggcctagcatggggcagccacag
ccgggaatgactgccaatggccctctacctgatccatctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacaacctggtttgaatcaatttggccagatgagc
atgccccagccccctattggaccccggcaaacctctcctcttcagcaccatggacagtta
gcccaacctggaactctcaacccgcctatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttcctcagactcagttctcaacacagggaatgaatgtaacaaat
atgcctttggctccgtctggcagtcaagcaccagtgtctcaagcacaaatgtccagttct
tcctgccctgtgaactctcctataatgcctcctgggtctcaagggagccacatgcactgt
ccccctctccctcaaccagctctgcatcagaactcaccctcacctgtacctagtcgtacc
ccaacccctcaccacactcccccaagcataggggctcagcagccaccagcaacagcaatt
ccagcccctgttcctacacctccagccatgccacctgggccacagtcccaggctctacat
cctcctccaagacaaacgcctacaccgccaccaacgcaacttcctccccaagcgcagcct
tcacttcctgctgctccttcagttgaccaggcgcagcagcagcctctgtcccagcagagt
acagcagcctctgtgcccaccccgacggcgccactgctgcctccgcagccggcaactcca
ctttcccagccagctgtaagcatcgaaggtcaggcatcaaaccctccatctactagtagc
acggaagtgaattctcaggccattcctgagaagcagccttcacaggaagtgaaaatggag
gctaaaatggaagtggatgcaccagaaccagcagatactcagccagaggatattccagag
actaaagcagaagactgtaaagcggaacctacagaaacagaagagagaggcgctgaatta
aaaactgaaacaaaagaggaggaagaccagccaagtacttcagcaacccagtcatctcca
gccccaggacagtcaaaaaagaagattttcaaacctgaagagttacgacaggcactgatg
ccgacattggaggcactttaccgacaggatccagaatcccttccctttcgtcaacctgtg
gacccccagcttctaggaatccctgattactttgatattgtgaagagccccatggatctt
tctactatcaaaaggaagttagacactggacagtatcaggagccctggcagtatgtggat
gacatttggcttatgttcaacaatgcttggttatataatcggaaaacatcacgggtgtac
aaatactgctccaagctgtctgaggtctttgaacaagaaattgacccagtcatgcaaagc
cttggatactgctgtggcagaaagttggagttctctccacagacactctgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacaataaataaagaacaattttcgaagagaaaaaatgacactctg
gatcctgaactgtttgttgaatgtacggagtgtggaagaaagatgcatcagatctgtgtc
cttcatcatgagatcatctggccatctggatttgtctgtgatggctgtttaaagaagact
gcacgaactagaaaagaaaataagttttctgctaaaaggttgccatctaccaggcttggc
acctttctggagaatcgtgtgaatgactttctgaggcgacaaaatcaccctgagtcagga
gaggtcactgttagagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatg
aaagcaaggtttgtagatagtggagagatggcagaatcctttccatatcgaaccaaagcc
ctctttgcctttgaggagattgatggtgttgacttgtgtttctttggcatgcacgttcaa
gagtatggttctgactgccccccgcccaaccagaggagagtatacatatcatacctggat
agtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcacgaaattctaatt
ggatatttggaatacgtcaagaaattaggatatacaacagggcatatttgggcatgcccc
ccaagtgagggagacgactacatcttccattgccacccccccgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgctcgacaaggctgtatccgagcgaatt
gtccacgactacaaggatatttttaaacaagctactgaagatcgattaacaagcgcaaag
gaattgccttactttgaaggtgatttctggcccaatgtactggaagagagcattaaggaa
ctggaacaggaggaggaagagagaaagcgagaggagaacaccagcaacgaaagcacagat
gtgacaaagggagacagcaaaaatgctaaaaagaagaataataagaaaactagcaaaaac
aagagcagcctgagtaggggcaataagaagaagccaggcatgcccaatgtatccaatgac
ctctcgcaaaaactgtatgccaccatggagaagcataaagaggtcttcttcgtgatccgt
ctcatcgccggccccgctgccaactccctgcctcccatcgttgatcccgaccccctcatc
ccctgcgacctgatggacgggcgggatgcctttctcaccctcgcaagggacaagcacctg
gagttctcctcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
acccagagccaggaccgcttcgtctacacttgcaacgagtgcaagcaccacgtggagacg
cgctggcactgcaccgtgtgcgaggattatgatttgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaagctgggtctcgggttagatgacgagagcaacaaccag
caggccgcggccacccagagcccgggggactcccgccgcctgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctccctgccctcctgccag
aagatgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggagggtgc
cccatctgcaagcagctcatcgccctctgctgctaccacgccaagcactgccaggagaac
aagtgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctgcag
caccggctccagcaagcccagatgctccgcaggaggatggccagcatgcagcgggctggc
gtggtggggcagcagcagggcctgccctcccccacgcctgcgaccccgaccacgcccacg
ggccagcagccgaccaccccgcagacgccctacttgcccaggactaaggctgctggcccg
gtgtcccagggcaaggcggccggccaggtcacccccccgacccctccgcagaccgctcag
ccaccccttccaggacccccgcctgcagcagtggaaatggcgatgcagattcagagggca
gccgagacgcaacgccagatggcccatgtgcaaagttttcaaaggccgatccagcaccag
atgccccaaatgactccgatggcccccatgggtatgaacgcaccccccatggccagaggt
cccggcgggcatttggagccaggggtggagcccacagggctgcagcagcctccaccgtgg
gcccaaggaggcttgcctcagccccagcacctgcagcccgggatgcccaggccagccatg
atgtcagtgtcacagcacggtcagcccctgaacatggctccccaaccgggattgggccag
gtaggtgtgagccctctcaaaccgggcactgtgtctcaacaagccttacaaaaccttctg
cggactctcaggtctcccagctcccccctgcagcagcaacaggtgcttagtatccttcac
gccaacccccagctgttggctgcgttcatcaagcagcgggctgccaagtacgccaacgcc
aatccgcagcccctccccgggcagcccggcgtgccccagggccagccagggctgcagccc
cccgccatgccgggccagcagggagtccactccagccccgccatgccgaacttgaatccc
atgcaggcgggcgtccagagggccggcctgccccagcagcaagcgccgcagcagcagctc
ccgccgcccatgggggggatgagcccccaggctcagcagatgagcatgaatcacagcacc
atgccggcgcagttccgagacattctgaggcggcagcagatgatgcagcagcagcagcag
cagcagcagcagcagcagcagggagcggggcccggagtcggccctggactggccagccac
agccagttccagccgccccagggcctgggctaccctgccccccagccgccgccgccgccc
cggatgcagcagcacatgcagcacctgcagcaagggagcgggggccagctgggcccgctc
ccccaggccctgggggcagaggcaggagccggtctgcaggcctatcagcagcgactcctt
cagcaacagatggggtcacccgctcagcccaaccccatgagcccccagcagcatatgctc
ccgagtcaggctcagtccccgcaccttccaggccagcagatcccgtctctctccaatcaa
gtgcggtctccccagcctgttccttctccgcggccacagtcccagcccccccactccagc
ccttccccacggatgcagcctcagccttctccacaccacgtttccccacagaccagttct
ccacatcccggactggtcgctgcccagggcaaccccatggaacaagggcattttgccagc
ccggaccagaattcgatgctctctcagctgactagcaatccaggcatggcaaacctccat
ggtgccagcgccacggacctgggactcggcgccgacaacgcagacttgaattcagacctc
tcacagagtacactagacatacactag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016523
Entry
103016523         CDS       T03086                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04024  cAMP signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04310  Wnt signaling pathway
bacu04330  Notch signaling pathway
bacu04350  TGF-beta signaling pathway
bacu04520  Adherens junction
bacu04630  JAK-STAT signaling pathway
bacu04720  Long-term potentiation
bacu04916  Melanogenesis
bacu04919  Thyroid hormone signaling pathway
bacu04922  Glucagon signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05016  Huntington disease
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05206  MicroRNAs in cancer
bacu05211  Renal cell carcinoma
bacu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103016523 (CREBBP)
   04330 Notch signaling pathway
    103016523 (CREBBP)
   04350 TGF-beta signaling pathway
    103016523 (CREBBP)
   04630 JAK-STAT signaling pathway
    103016523 (CREBBP)
   04066 HIF-1 signaling pathway
    103016523 (CREBBP)
   04068 FoxO signaling pathway
    103016523 (CREBBP)
   04024 cAMP signaling pathway
    103016523 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103016523 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103016523 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103016523 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    103016523 (CREBBP)
   04919 Thyroid hormone signaling pathway
    103016523 (CREBBP)
   04916 Melanogenesis
    103016523 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    103016523 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016523 (CREBBP)
   05206 MicroRNAs in cancer
    103016523 (CREBBP)
   05203 Viral carcinogenesis
    103016523 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    103016523 (CREBBP)
   05215 Prostate cancer
    103016523 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103016523 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103016523 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103016523 (CREBBP)
   05161 Hepatitis B
    103016523 (CREBBP)
   05164 Influenza A
    103016523 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103016523 (CREBBP)
   05165 Human papillomavirus infection
    103016523 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103016523 (CREBBP)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103016523 (CREBBP)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103016523 (CREBBP)
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103016523 (CREBBP)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    103016523 (CREBBP)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103016523 (CREBBP)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    103016523 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 103016523
NCBI-ProteinID: XP_007181605
UniProt: A0A384A2L5
LinkDB
Position
Un
AA seq 2444 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNPAQQGQAQVMNGSLGAAGRGRGAGMPYATPAMQGAASSVLA
ETLTQVSPQMASHAGLNTAQAGGMSKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFAADIKNASVTNVPNMSQMQTSVGIGPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPSGGITTDQ
QPPNLISESALPTSLGAANPLISDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMPLPVNRMQVSQG
MNSFNPISLGNVQLPQAPMGPRASSPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGTHA
NNMMAQAPAQNQFLPQNQFPSSSGALNVNSVGMGQPAAQASVSQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTATGMPSLQHPAAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQQPTPVHTQP
PGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPMLEMKAEVKTEDTEPDASEPKAE
PGAAMMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVEAKEEEESSTNGTASQSTS
PSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLS
TIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
GYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPS
QPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTG
RTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMK
SRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDS
IHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKP
KRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKEL
EQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSND
LSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHW
EFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTK
SHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQ
KMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQ
HRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSPPQTPQPPAQPQPSPVNM
SPAGFPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVN
INNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVVPSLPPGQWQQAPIPQQQPMPGMP
RPVMSMQAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQL
MAAFIKQRTAKYVASQPGLQPQPGLQPQPGLQSQPGLHQQPSLQNLNAMQAGGPRPGVPP
QQPAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQG
SAGMAGGMAGHSQFQQPQGPGGYPAAMQQQRMQQHLPIQGSSMGQMAAQMGQLSQMGQPG
LGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATS
LSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQG
HLGNPEQSAMLPQLNTPNRSALSNELSLVGDTTGDTLEKFVEGL
NT seq 7335 nt   +upstreamnt  +downstreamnt
atggccgaaaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cccgatgagctgatccccaatggaggagaattaggccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcagagcttctgcgaggaggcagcagctct
agtatcaacccaggaataggaaatgtgagcgccagcagccccgtgcaacaaggcctcgga
ggccaggcccaggggcagccgaacagtgcgaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttcagcccccagcctgcccaaacaggcagccagcacc
tctgggcccactccccctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcacagacgggacctgggatctgcatgaatgctaat
tttaaccagacccacccaggcctcctcaatagtaactctggccatagtttaatgaacccg
gcccagcaagggcaggcgcaagtcatgaatggatctcttggggctgctggcagaggaagg
ggagctggaatgccatacgctactccggccatgcagggggccgcgagcagcgtgctggct
gagacgttaactcaagtttcaccgcaaatggccagtcatgcaggactgaacacagcgcaa
gccggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcagatgggagcccctggagtgaaccctcagctgcccagcaag
cagagcatggtcaatagcttgcctcccttcgctgcagacatcaagaatgcttcagtcacc
aacgtgccaaacatgtctcagatgcaaacatcagtgggaattggacccacacaggcaatt
gcaacgggccctactgcagatcctgaaaaacgcaaactgatacagcagcagctggttcta
ctgcttcacgctcataaatgtcagaggcgagaacaagcaaatggagaggttcgggcctgc
tctctcccacattgtcgaaccatgaaaaatgttttgaatcacatgacacattgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacacaattggttctgtt
ggcacaggccaacagaatgccacttctttaagtaacccaaatcccatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggact
ctcaaccccctgggaaataacccaatgaacattccatcaggaggaataacaacagatcag
cagccaccaaacttgatttcagaatcagctcttccaacttcccttggggccgcaaaccca
ctgatcagtgacggctcaaactctggaaacattggaaccctcagcactatacccacagca
gcacctccttccagcactggcgttcggaaaggctggcatgaacatgtcactcaggacctg
aggagccatctagtgcataaacttgtccaagccatcttcccaacacctgaccctgcagcc
ctgaaggatcgccgcatggagaacctggtggcctacgctaagaaagtggaaggggacatg
tatgagtctgccaacagcagggatgagtactatcacttactagcagagaaaatctacaag
atacaaaaagaactagaagaaaaacggagatcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttaccagcccccgggacacagcctcctgggataccacaggcacagcct
gtgagacctccaaatgggcccatgcctctgccagtgaatcgcatgcaggtttctcaaggg
atgaattcatttaacccaatatccttggggaatgtacagttgccacaagctcccatggga
cctcgtgcatcgtcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccttcccgaatgcctcagcctcctaacatgatgggtacacacgcc
aacaacatgatggcccaggcgcctgcccagaaccagttcctgccacagaaccagttcccg
tcctccagcggggcgctgaacgtgaacagcgtgggcatggggcagccggcggcccaggcc
agcgtgtcacagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagtcaccgttacaccagactcca
cctcctgcttccacggccacaggcatgccgtctcttcagcatccggcggcacctgggatg
actcctccccagccagcagctcccacccagccatcaactcctgtgtcgtcttccgggcag
actcccaccccaactcccggctcagtgcccagtgccagccaaacccagagcacccctaca
gtccaggcggcagcccaggcccaggtgaccccacagcctcagaccccagtccagcctccg
tccgtggccacccctcagtcgtcacagcagcagcagccgacacctgtgcacacccagcct
cctggcacaccgctttcccaggcagcagccagcattgataacagagtccccactccatcc
tcagtggccagcgccgaaaccaactcccagcagccaggacccgatgtaccaatgctggaa
atgaaggctgaggtcaagaccgaggacactgagcccgatgccagtgaacccaaggcagag
cctggggctgcgatgatggaggaggacttacaaggatcttctcaagttaaagaagaaaca
gacacaacagagcagaagtcggaaccaatggaagtggatgaaaagaaacctgaagtgaaa
gttgaagctaaagaggaagaagagagtagcaccaacgggacagcctctcagtccacttct
ccttctcagcctcgcaaaaaaatctttaagccggaagagttgcgccaggctctgatgcca
accctagaagcgctgtatcgacaggatccagagtccctaccttttcggcagcctgtagat
ccccagctcctaggaattccagattattttgacattgtgaagaatcccatggacctttcc
accatcaagcggaagctggatacagggcagtaccaggaaccctggcagtatgtggatgac
gtctggctcatgttcaacaatgcctggctctacaatcggaagacatcccgggtctataag
ttctgcagtaagctcgcagaggtctttgagcaagaaattgaccctgtcatgcaatccctt
ggatattgctgtggacgcaagtatgagttttccccacagactttgtgctgctacgggaag
cagctgtgtacaattcctcgcgatgccgcctactacagctatcagaataggtatcatttc
tgtgagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttca
caaccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagat
cctgaacctttcgttgattgcaaggagtgtggccggaagatgcatcagatttgtgttctc
cactatgatatcatttggccttcaggctttgtgtgcgacaactgcttgaagaaaacgggc
agaactcgtaaagaaaacaaattcagtgctaagagactgcagaccacacggttgggaaac
cacttggaagaccgagtcaacaagtttttgcggcgacagaatcatcctgaagccggggag
gtgtttgtccgcgtagtggccagctcagacaagacggtggaggtcaagcccgggatgaag
tcacggtttgtggattctggggaaatgtctgaatctttcccgtatcgaaccaaagcactc
tttgcctttgaggaaattgatggagtggatgtgtgcttctttgggatgcacgtccaagag
tatggctctgattgcccccctccaaacacaaggcgtgtgtacatatcttatctggacagt
attcatttcttccgaccccgatgcctccgaacagctgtttaccatgagatccttattgga
tatttagagtacgtgaagaaattggggtatgtaacaggacacatctgggcctgtccccca
agtgaaggagacgactacatcttccattgccaccccccggatcaaaaaatccccaagcca
aagcgcctgcaggagtggtacaagaagatgctggacaaggcctttgccgagcgcatcatc
catgactataaggacattttcaaacaagcaactgaagacaggctcaccagtgccaaggaa
ctgccctatttcgagggtgacttttggcctaacgtgttggaggagagcattaaggagctg
gaacaggaggaagaagagaggaagaaggaggagagcaccgcggccagtgagaccccagag
ggcagccagggcgacagcaagaacgccaagaaaaagaacaacaagaaaaccaacaagaat
aaaagcagcatcagccgagccaacaagaaaaagcccagcatgcccaacgtgtccaacgac
ttgtcccagaagctctatgccacgatggagaagcacaaagaggtcttctttgtgatccac
ctccacgctgggcccgtcatcaacacgctgccccccattgtcgaccccgaccccctgctc
agctgtgacctcatggatgggcgggacgccttcctcacgctggcccgggacaagcattgg
gagttctcctccctgcggcgctccaagtggtccacgctgtgcatgctggtggagctgcac
acccagggccaggaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacg
cgctggcactgcaccgtgtgcgaggactacgacctctgcatcaactgctacaacacgaag
agccacacccacaagatggtgaagtgggggctgggcctggacgacgagggcagcagccag
ggtgagccacagtccaagagcccccaggagtcgcggcgcttgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctcactgccgtcctgccag
aagatgaagcgggtggtgcagcacaccaagggttgcaagcgcaagaccaacggcggctgc
ccagtgtgcaagcagctcattgccctctgctgctaccacgccaaacactgccaagaaaac
aagtgccccgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccag
caccgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaac
gtgcctcagcagagcctgccttcccctacctcagcaccacccgggacccccacgcagcag
cccagccctccccagacgccacagccccccgcccagccgcagccgtcgcccgtgaacatg
tcaccagccggcttccccagtgtggcccggactcagcccccaacaacggtgtccaccggg
aagcccaccaaccaggtgccggccccaccgccccccgcccagcccccgcccgcggcagtg
gaggcggcccggcagatcgagcgggaggcccagcagcagcagcacctgtaccgggtgaac
atcaacaacggcatgcccccggggcgcacgggcatggtgacgccggtgagccagatggcc
cccgtgggcctgaacgtgccccgacccaaccaggtcagcgggcccgtagtgcccagcctg
ccacctgggcagtggcagcaggcgcccatcccccagcagcagccgatgccaggcatgccc
agacccgtgatgtccatgcaggcccagccagccgtggccgggccgcggatgcccagcgtg
caaccaccccggagcatctcgcccggcgccctgcaggacctgcttcggaccctgaagtcc
cccagctccccacagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctg
atggcagctttcattaaacagcgcacggccaagtacgtggccagtcagcccggcctgcag
ccccagcccggcctgcagccccagcccggcctgcagtcccagcccggcctgcaccagcag
cccagcctgcagaacctgaatgccatgcaagccggcgggccccggcccggcgtgcctcca
cagcagccggcgatgggcggcctgaacccccagggccaggccctgaacatcatgaacccg
gggcacaaccccagcatggcaagtatgaacccacagtacagagagatgctgcgaaggcag
ctcctgcagcagcagcagcagcagcagcaacagcagcagcagcagcagcagcagcagggc
agtgccggcatggccgggggcatggcggggcacagccagttccagcagcctcagggaccc
ggaggctaccccgcggccatgcagcagcagcggatgcagcagcacctccccatccagggc
agctccatgggccagatggcggcccagatgggacagctcagccagatggggcagcctggg
ctgggcgcagacagcacccccaacatccagcaggccctgcagcagcggattctgcagcag
cagcagatgaagcagcagattgggtccccgggccagccgaaccccatgagcccccagcag
cacatgctctcaggacagccgcaggcctcgcacctccccggccagcagatggccacgtcc
ctcagtagccaggtgcggtctccggcccctgtccagtctccacggccccagtcccagcct
ccacattccagcccgtcgccacggatacagccccagccttcaccacaccacgtctcgccc
cagactggttccccccacccaggactcgcagtcaccatggccagctccatagatcaggga
cacttggggaaccccgaacagagtgcaatgctcccccagctgaacacccccaacaggagt
gcgttgtccaatgagctgtccctggtcggcgacaccacgggagacaccctagaaaagttt
gtggagggtttgtag

DBGET integrated database retrieval system