KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000066
Entry
103000066         CDS       T03086                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04062  Chemokine signaling pathway
bacu04611  Platelet activation
bacu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103000066 (RASGRP2)
   04014 Ras signaling pathway
    103000066 (RASGRP2)
   04015 Rap1 signaling pathway
    103000066 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103000066 (RASGRP2)
   04062 Chemokine signaling pathway
    103000066 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103000066 (RASGRP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    103000066 (RASGRP2)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   103000066 (RASGRP2)
SSDB
Motif
Pfam: RasGEF EF-hand_1 EF-hand_6 C1_1 EF-hand_5 EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 103000066
NCBI-ProteinID: XP_007174355
UniProt: A0A383ZGS5
LinkDB
Position
Un
AA seq 581 aa
MALCSCPLASSSVLSKLSTSVECLWTLSGQNLSFLPLFLHDTLCRPLPRDLCTCATLFRD
CLFLCLSPSVDCELLGGRNRVLLISVPPAPSTVPGTDPTYKWNRQVTQRNPVEQKKRKMS
LLFDHLDPMELAAHLTYLEYCSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWV
QLMILSKPTAPQRALVITHFVHVAEKLLELQNFNTLMAVVGGLSHSSISRLKETHSHVSP
ETIKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPTRT
RLNGAKMKQLFSILEELAMVTSLQPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPR
SKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALMVEHIEKMVESVFRNFDVDGDGHIS
QEEFQIIRGNFPYLSAFGDLDQNQDGCISKEEMVSYFLRSSSVLGGRMGFVHNFHESNSL
RPVTCRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPT
HTHHRAFSFSLPRPGRRGSRPPEIREEDVQMVEDGVFDIHL
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggctctttgctcatgtccccttgcctcctcctccgtgttatcaaagctcagcacaagt
gtggagtgtctgtggactctttcagggcagaatttgtcgttcctgcctctgttcctccat
gacactttgtgcagacccctgcccagagacctctgcacttgtgccacgctatttcgtgat
tgtttgtttctgtgtctgtctccctcagtagactgtgagctcctcgggggcaggaaccgt
gtcttgctcatctctgtacccccagcgcctagcacagtgcctggcacagaccccacctac
aagtggaatcggcaggtgacccagaggaaccctgtggaacagaaaaagcgcaagatgtcc
ctgttgtttgaccacctggaccccatggagctggcagcacatctcacctacttggaatat
tgctccttttgcaagatcctgttccaggactatcacagtttcgtgactcacggctgcacc
gtggacaaccctgtcctggagcgattcatctccctcttcaacagtgtctcgcagtgggtg
cagctcatgattctcagcaagcccacagccccgcagcgggccctggtcatcacacacttc
gtccacgttgcagagaaactcctggagctgcagaatttcaacacgctgatggcggtggtc
gggggcctgagccacagctccatctcccgcctcaaggagacccacagccacgtgagcccg
gagaccatcaagctctgggaaggtctgacagaactagtgacggccactggcaactatggc
aactaccggcgccggctggcagcctgcgtgggtttccgcttccccatcttgggtgtgcac
ctcaaggacctggtggccctgcagctggcactgcctgactggctggaccccacccggacc
cgacttaatggggccaagatgaagcagctcttcagcatcctggaggagctggccatggtg
accagccttcagcccccagtgcaagccaaccccgacctgctgagcctgctgacggtgtct
ctggatcagtatcagacagaggatgagctctaccagctgtccctgcagcgggaaccgcgc
tccaagtcctcgccaaccagccccaccagctgcacgccgccgccccggcccccggtgctg
gaggagtggacctcagcggccaaacccaagctggatcaggcactcatggtggagcacatt
gagaagatggtggagtctgtgttccggaacttcgatgtcgatggggacggccacatctca
caggaggagttccagatcatccgtgggaactttccttacctcagcgcctttggagacctc
gaccagaaccaggatggctgcatcagcaaggaggagatggtctcctactttctgcgctcc
agctctgtgctgggtggccgcatgggcttcgtacacaacttccacgagagcaactccttg
cgcccggtcacctgccgccattgcaaggccctgatcctgggcatctacaagcagggcctc
aaatgccgagcctgtggtgttaactgccacaagcagtgcaaggatcggctgtcagttgag
tgccggcgccgggcccagagtgtgagtctggaggggtctgcaccctcaccctcacccaca
catacccaccatcgcgccttcagcttctccctgccccgccctggcaggcgaggctcccgg
cctccagagatccgagaggaggacgttcagatggtggaggacggcgtgtttgacatccac
ttgtaa

DBGET integrated database retrieval system