KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000257Help
Entry
103000257         CDS       T03086                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04614  Renin-angiotensin system
bacu04924  Renin secretion
bacu05142  Chagas disease (American trypanosomiasis)
bacu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    103000257
   04614 Renin-angiotensin system
    103000257
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103000257
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    103000257
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103000257
Peptidases [BR:bacu01002]
 Metallo Peptidases
  Family M2
   103000257
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103000257
CD molecules [BR:bacu04090]
 Proteins
  103000257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Mucin HupF_HypC
Motif
Other DBs
NCBI-GeneID: 103000257
NCBI-ProteinID: XP_007175845
LinkDB All DBs
Position
Un
AA seq 738 aa AA seqDB search
MGQGWAAPGLSRLLLLLLLCCGHPLLAPGQGTTSQGTTGQVSVNQGTTSRATTSSQTTTR
HPTTSSPKTQSPNLVSDEAEASKFVEECDQRSRVVWNEYAEANWDYSTNITKEGSKILLE
KNVQMANHTVKYGTWARKFDVTNFQNATMKRMIKKIQDLERAALPVKELEEYNQILLDME
TTYSVASVCYSNGTCLRLEPDLTNLMATSRNYEELLWAWKGWRDKVGRSILPYFPKYVEL
TNKAARLNGYEDGGDSWRSMYEMPFLEYDLEQLFQELQPLYLNLHAYVRRALYRFYGSEF
INLEGPIPAHLLGNMWAQSWSNIYDLVVPFPSAPRMDATEAMIKQGWTPQRMFKEADDFF
TSLGLLPVPPEFWNKSMLEKPTDGREAVCHASAWDFFNGRDFRIKQCTTVNMEDLVVAHH
EMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVSTPKHLHKINLLSSGDGSYEED
INFLMKMALDKIAFVPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVARSQ
GDFDPGAKFHIPSSVPYIRYFVSFVIQFQFHEALCQAAGHKGPLHECDIYQSQEAGKRLA
DAMKLGSSRPWPEAMRLITGQPNMSAAAMMTYFKPLLDWLVTENGRHGEKLGWPQYNWTP
NSARLEDSFPGSGRVNFLGLSLEEEQARVGQWVLLFLGVALLVATLGLTQRLFSIRHRSL
HQPHPEPQFGSEVELRHS
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaggttgggctgctccaggactgtcccgcctcctcctcctcctccttctctgc
tgtgggcacccgctgctggcccctggccaggggaccaccagccaggggaccaccggccag
gtgtcagtcaaccagggaacaaccagccgggcaacaaccagcagccagacgactacccgc
cacccaacaaccagcagcccgaaaacccagagcccaaacctggtgtccgacgaggctgag
gccagcaagtttgtggaggaatgtgaccagagatcccgggtggtgtggaacgagtatgcc
gaggccaactgggactacagtaccaacatcaccaaggagggcagcaagatactgctggag
aagaatgtacagatggcaaaccacactgtcaagtacggcacctgggccaggaagtttgat
gtgaccaacttccagaacgccaccatgaagcggatgataaagaagattcaggatctagag
cgggcggcactgcctgtcaaggagctggaggagtacaaccagatcctgctggacatggag
accacttacagcgtggcctctgtgtgctatagcaatggcacttgtctacggctcgagcct
gatctgacaaatctgatggccacatcccggaactatgaagaactgctgtgggcatggaag
ggctggcgagacaaggtggggagatccatcctcccgtatttccccaaatacgtggagctc
accaacaaggctgccaggctcaatggctacgaggacggaggggactcctggagatctatg
tacgagatgccattcctggagtacgacctggagcagctcttccaggagctgcagccgctc
tacctgaacctgcacgcctacgtgcgccgggccctgtatcgcttctacgggtctgagttc
atcaacctggagggccccatcccagcccacctgctggggaacatgtgggcacagagctgg
tccaacatctatgacttggtagtacccttcccttcagcccccaggatggatgccacagag
gccatgataaagcagggctggacaccccaaaggatgtttaaggaagcggacgatttcttc
acctccctggggctgctgcccgtgccccccgagttctggaacaagtccatgctggagaag
ccgaccgacgggcgggaggcggtatgccacgcctccgcctgggacttcttcaacggcagg
gatttcaggatcaagcagtgcaccactgtgaacatggaggacctggtggtggcccaccac
gaaatgggccacatacagtatttcatgcagtacaaggacttgcctgtgaccttccgggag
ggtgccaaccctggttttcacgaggccattggggatgtgctggccctctcagtgtctacc
cccaagcacctgcacaagatcaacctgctgagtagtggggacggcagctatgaggaggac
atcaactttctgatgaagatggcgctcgacaagatcgcctttgttcccttcagctatctg
gtggaccagtggcgctggagggtatttgacggaagcatcaccaaggagaactacaaccag
gagtggtggagcctcaggctgaagtaccagggcctctgtcccccagtggccaggtctcaa
ggcgactttgacccaggggccaagttccacattccttcaagcgtaccatatatcaggtat
ttcgtcagcttcgtcatccagttccagttccacgaggcgctgtgtcaggcggcgggccac
aagggccccctgcacgagtgcgacatctaccagtcccaggaggccgggaagcgcctggcg
gacgccatgaagctgggctccagtcggccgtggcccgaagccatgcggctcatcacgggc
cagcccaacatgtcggccgctgccatgatgacctacttcaagccgctgctggactggctc
gtgaccgagaatgggcggcacggggagaagctgggctggcctcagtacaactggacgcca
aactcagctcgcttggaagactccttcccgggctccggccgcgtcaacttcctgggcctg
agcctggaggaggagcaggcccgcgtgggccagtgggtgctgctcttcctgggcgtcgcc
ctgctggtggccacgctgggcctcacccagcggctcttcagcatccgccaccgcagcctc
caccagccccaccccgagccccagtttggctccgaggtggagctcagacactcctga

DBGET integrated database retrieval system