KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000458
Entry
103000458         CDS       T03086                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04062  Chemokine signaling pathway
bacu04217  Necroptosis
bacu04380  Osteoclast differentiation
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103000458 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103000458 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103000458 (STAT2)
   04625 C-type lectin receptor signaling pathway
    103000458 (STAT2)
   04062 Chemokine signaling pathway
    103000458 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103000458 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103000458 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103000458 (STAT2)
   05160 Hepatitis C
    103000458 (STAT2)
   05171 Coronavirus disease - COVID-19
    103000458 (STAT2)
   05164 Influenza A
    103000458 (STAT2)
   05162 Measles
    103000458 (STAT2)
   05168 Herpes simplex virus 1 infection
    103000458 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103000458 (STAT2)
   05169 Epstein-Barr virus infection
    103000458 (STAT2)
   05165 Human papillomavirus infection
    103000458 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103000458 (STAT2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103000458 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_bind STAT_int SH2 CorA
Other DBs
NCBI-GeneID: 103000458
NCBI-ProteinID: XP_007179660
UniProt: A0A383ZX10
LinkDB
Position
Un
AA seq 879 aa
MAQWEMLQNLDSPFQDQLHQLYSNSLLPVDIRQYLAVWIEDQNWQEAALGNDEAKANMLF
FHFLDQLNYECSRCSQDPECLLLQHNLRKFYRDIQAFPQGATQLAEMIFNLLLEEKRILT
QAQRAQSEQGEPALAASGESQQHEIESRILELKAMLEKLVKSISQLKDQQDVFCFRYKIQ
TSARTPSLDPHQTRQKDILQETLNELDRRRKEVLDASKALLGRLTTLIELLLPKLEEWKV
RQQKACIGGPPDGGLEQLEKWFTAGAKLLFHLRQLLKELQGLSHMVTYQGDPLIEGVDLR
KAQVTELLQRLLHRAFVVETQPCMPQTSHRPLILKTGSKFTVRTRLLVRLQEGNESLTAE
VSIDRNPPESQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLAVTEELHIISFTVRYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSSNPQ
NQQFFSSPAKAPWDLLGPALSWQFSSYVGRGLDSDQLGMLRDKLFGQNSRTEGALLSWVH
FIKRESPPGKLPFWTWLDKILDLVHDHLKDLWNDGRIMGFVSRSQERRLLKKTISGTFLL
RFSETLEGGITCSWVEHQDDDKVLIYSVQPFTKEVLQSLPLTKIISQYQLLTEENIPENP
LCFLYPRIPRDEAFGCYSQEKVNLQERKKYLKHKLIVVSNRQVDELQQLPELKLEPELES
LELDLGLAPGPEPGPGLGLEPLLEAGLDLGPALESTLEPTLEPVLESILEPTLESILEPM
LEPTLGEVSQRVPEPNLGPGLKLEPIPEPISQPLPEPDLPHDLRHLNTEDMEIFRNSRKI
EEIMPNGDPLLAGQNTMDEAYVFPRSHFYTDGPLIPSDY
NT seq 2640 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgctacagaatcttgacagcccatttcaggatcagctgcaccag
ctctattcaaatagcctcctgccggtggacattcgacagtacttggctgtctggattgaa
gatcagaactggcaggaagctgcactgggcaatgatgaggccaaggctaatatgctgttc
ttccacttcttggaccaactgaactatgagtgtagccgctgcagccaggaccctgagtgt
ttgttgctacagcacaacttgcgaaaattctatcgggacattcaggcctttccccagggc
gctacccaattggctgagatgatctttaatctccttctggaagaaaaaagaattctgacc
caggctcagagggctcagtcggagcaaggagagccagcccttgcagcatctggggagagc
cagcagcatgagattgaatcgcggatcctggaattaaaggctatgttggagaagctggtg
aaatccatcagccaactgaaagaccagcaggatgtcttctgcttccgatataagatccag
acctcagcgaggacaccctctttggacccccatcagaccagacagaaggacattctgcag
gaaacgctcaatgaactggacagaaggagaaaggaggtgctagatgcctccaaagcactg
ctaggccgattaactaccctaattgagctactgctgcccaagctggaggagtggaaagtt
cggcagcagaaagcctgcattggaggccccccggatggagggttggagcagttggagaag
tggttcacagctggagcaaagctgttgtttcatctgcggcagctgctgaaggagctacag
ggattgagtcacatggtcacctatcaaggggaccctctgatcgaaggggtggatctgcgg
aaggcccaggtcacagagctgctacagcgcctgctccacagagcctttgtagtagaaacc
cagccctgcatgccccaaacttcccatcgacccctcatcctcaagactgggagcaagttc
accgtccgaacaaggctgctggtgagactccaggaaggcaatgagtcactgactgcagaa
gtctccattgacagaaatcctcctgaatcacaaggcttccggaagttcaacattctgacc
tcaaaccagaaaactttgactcctgagaaagggcagagtcagggcttaatttgggacttt
ggctacctgacgctggtggagcagcgttcaggtggttcaggaaagggcagcaataagggg
ccgctggccgtgacagaggaactgcacattatcagcttcacagtcagatatacctaccag
ggtctgaagcaggaactgaaaacggacacccttcctgtggtgattatttctaacatgaac
caactctcaattgcctgggcctcggttctctggttcaatctgctcagctcaaacccccag
aatcagcagttcttctccagccccgccaaggccccctgggacttgctgggccctgccctc
agttggcaattctcctcctacgttggccgaggcctcgactcagaccagcttggcatgctg
cgggacaagctgtttgggcagaactccaggactgagggtgccttgttgtcctgggtccat
ttcattaagcgagagagcccccctggcaagctaccattctggacatggctcgacaaaatt
ctggacctggtacatgaccacctgaaggatctctggaacgatggacgcatcatgggcttt
gtgagccggagccaggagcgccggctgctgaagaagaccatctctggcacctttctgctg
cgcttcagtgaaacattggaagggggcattacctgctcctgggtggaacaccaagatgat
gataaggtgctcatctactctgtgcagcccttcaccaaggaggtgctgcagtcactcccg
ctgaccaaaatcatcagccagtaccagctgctcactgaggagaacatacctgagaaccca
ctgtgcttcctctacccacgaatcccccgggatgaggcttttgggtgctactcccaggag
aaagttaatctccaggaacggaagaaatacctgaaacataagctcattgtggtctctaac
agacaggtggatgagctgcaacaactgccggagcttaagctggagccagaactggagtca
ttagagctggatctggggctggcaccagggccagagccagggccgggcctgggcttagag
ccactgctggaggcagggctggatctggggccagcactggagtccactctggagcccact
ctggagcccgtgctggagtccattctggagcccacactggagtccattctggagcccatg
ctggagcccacactaggcgaggtgtcacagagagtcccagagccaaacctgggaccagga
ctgaagctggagcctattccagagcctatttcacagccactgccagagccggatttgccc
catgatctgagacacttgaacactgaggacatggaaatcttcagaaacagcaggaagatt
gaagaaatcatgccaaatggtgacccactgttggctggccagaacaccatggatgaagct
tacgtcttccctcgcagccatttctacacagatgggcccttgattccttctgactactag

DBGET integrated database retrieval system