KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000540
Entry
103000540         CDS       T03086                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu04530  Tight junction
bacu04660  T cell receptor signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04934  Cushing syndrome
bacu05160  Hepatitis C
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05212  Pancreatic cancer
bacu05214  Glioma
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103000540 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103000540 (CDK4)
   04115 p53 signaling pathway
    103000540 (CDK4)
   04218 Cellular senescence
    103000540 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103000540 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103000540 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103000540 (CDK4)
   05203 Viral carcinogenesis
    103000540 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103000540 (CDK4)
   05225 Hepatocellular carcinoma
    103000540 (CDK4)
   05214 Glioma
    103000540 (CDK4)
   05220 Chronic myeloid leukemia
    103000540 (CDK4)
   05218 Melanoma
    103000540 (CDK4)
   05219 Bladder cancer
    103000540 (CDK4)
   05224 Breast cancer
    103000540 (CDK4)
   05222 Small cell lung cancer
    103000540 (CDK4)
   05223 Non-small cell lung cancer
    103000540 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103000540 (CDK4)
   04934 Cushing syndrome
    103000540 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103000540 (CDK4)
   05160 Hepatitis C
    103000540 (CDK4)
   05164 Influenza A
    103000540 (CDK4)
   05162 Measles
    103000540 (CDK4)
   05163 Human cytomegalovirus infection
    103000540 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103000540 (CDK4)
   05169 Epstein-Barr virus infection
    103000540 (CDK4)
   05165 Human papillomavirus infection
    103000540 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103000540 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103000540 (CDK4)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103000540 (CDK4)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103000540 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 103000540
NCBI-ProteinID: XP_007179756
UniProt: A0A383ZXH0
LinkDB
Position
Un
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacccctcgatatgagccagtggctgagattggtgttggtgcctatgggacggtg
tataaggcccgtgatccccacagtggccactttgtggccctcaagagcgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcacagttcgtgaggtggctttactg
cggcggctggaggcttttgagcatcccaatgttgtgcggctgatggacgtctgtgccaca
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccgccaggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcatcgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctccagaagttcttttgcagtctacatatgcaacacctgtggacatgtggagtgtt
ggctgtatcttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcggactgcctccagaggatgactggccccga
gatgtgtctctaccccgaggagccttttcccccagagggccccgccccgtgcagtcggtg
gtacctgagatggaagagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt
aacccagagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010593
Entry
103010593         CDS       T03086                                 

Definition
(RefSeq) cyclin-dependent kinase 4-like
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu04530  Tight junction
bacu04660  T cell receptor signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04934  Cushing syndrome
bacu05160  Hepatitis C
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05212  Pancreatic cancer
bacu05214  Glioma
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103010593
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103010593
   04115 p53 signaling pathway
    103010593
   04218 Cellular senescence
    103010593
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103010593
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103010593
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010593
   05203 Viral carcinogenesis
    103010593
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103010593
   05225 Hepatocellular carcinoma
    103010593
   05214 Glioma
    103010593
   05220 Chronic myeloid leukemia
    103010593
   05218 Melanoma
    103010593
   05219 Bladder cancer
    103010593
   05224 Breast cancer
    103010593
   05222 Small cell lung cancer
    103010593
   05223 Non-small cell lung cancer
    103010593
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103010593
   04934 Cushing syndrome
    103010593
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103010593
   05160 Hepatitis C
    103010593
   05164 Influenza A
    103010593
   05162 Measles
    103010593
   05163 Human cytomegalovirus infection
    103010593
   05167 Kaposi sarcoma-associated herpesvirus infection
    103010593
   05169 Epstein-Barr virus infection
    103010593
   05165 Human papillomavirus infection
    103010593
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103010593
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103010593
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103010593
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103010593
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 103010593
NCBI-ProteinID: XP_007184194
LinkDB
Position
Un
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDLHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
IRQFLRGLDFLHANCIVHRDLKPENILVTSGGAVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGVFSPRGPRPVQSVVPEMEETGEQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacccctcgatatgagccagtggctgagattggtgttggtgcctatgggacggtg
tataaggcccgtgatctccacagtggccactttgtggccctcaagagcgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcacagttcgtgaggtggctttactg
cggcggctggaggcttttgagcatcccaatgttgtgcggctgatggacgtctgtgccaca
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccgccaggcttgccagtggagaccatcaaggatctg
atacgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcatcgagac
ctgaagccagagaacattctggtgacaagtggtggggcagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctccagaagttcttttgcagtctacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcggactgcctccagaggatgactggccccga
gatgtgtctctaccccgaggagtcttttcccccagagggccccgccccgtgcagtcagtg
gtacctgagatggaagagactggagaacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system