KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000566
Entry
103000566         CDS       T03086                                 

Gene name
RHEB
Definition
(RefSeq) Ras homolog enriched in brain
  KO
K07208  Ras homolog enriched in brain
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04218  Cellular senescence
bacu04714  Thermogenesis
bacu04910  Insulin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    103000566 (RHEB)
   04151 PI3K-Akt signaling pathway
    103000566 (RHEB)
   04152 AMPK signaling pathway
    103000566 (RHEB)
   04150 mTOR signaling pathway
    103000566 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103000566 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    103000566 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103000566 (RHEB)
   04919 Thyroid hormone signaling pathway
    103000566 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    103000566 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    103000566 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103000566 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103000566 (RHEB)
   05163 Human cytomegalovirus infection
    103000566 (RHEB)
   05165 Human papillomavirus infection
    103000566 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bacu04031]
    103000566 (RHEB)
GTP-binding proteins [BR:bacu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    103000566 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase
Other DBs
NCBI-GeneID: 103000566
NCBI-ProteinID: XP_007165475
UniProt: A0A383YRJ1
LinkDB
Position
Un
AA seq 179 aa
MPVRTQLLLSLIGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQD
EYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHM
ERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSSCSVM
NT seq 540 nt   +upstreamnt  +downstreamnt
atgccagtgcgtactcagctattgctctctcttatagggaaatcctcattgacgattcag
tttgtcgaaggccaatttgttgattcctacgatccaaccatagaaaacactttcacaaaa
ttgatcacagtaaatggacaagaatatcatcttcaacttgtagatacagctgggcaggat
gaatattccatctttcctcagacatactccatagatattaatggttatattcttgtgtat
tctgttacatcaatcaaaagctttgaagtgatcaaagttatccatggcaaactgttggat
atggtggggaaagtacagatacctattatgttggttgggaataagaaagacctacatatg
gaaagggtgatcagttatgaagaagggaaagcgttagcagaatcttggaacgcagctttt
ttggaatcttctgctaaagaaaatcagactgctgtcgatgtttttagaaggataattttg
gaggcagaaaaaattgatggggccgcttcacaaggaaagtcttcctgctcagtgatgtga

DBGET integrated database retrieval system