KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000583Help
Entry
103000583         CDS       T03086                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00051  Fructose and mannose metabolism
bacu00052  Galactose metabolism
bacu00500  Starch and sucrose metabolism
bacu00520  Amino sugar and nucleotide sugar metabolism
bacu00524  Neomycin, kanamycin and gentamicin biosynthesis
bacu01100  Metabolic pathways
bacu01200  Carbon metabolism
bacu04066  HIF-1 signaling pathway
bacu04910  Insulin signaling pathway
bacu04930  Type II diabetes mellitus
bacu04973  Carbohydrate digestion and absorption
bacu05230  Central carbon metabolism in cancer
Module
bacu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bacu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103000583 (HKDC1)
   00051 Fructose and mannose metabolism
    103000583 (HKDC1)
   00052 Galactose metabolism
    103000583 (HKDC1)
   00500 Starch and sucrose metabolism
    103000583 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    103000583 (HKDC1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103000583 (HKDC1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    103000583 (HKDC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103000583 (HKDC1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103000583 (HKDC1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    103000583 (HKDC1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103000583 (HKDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103000583 (HKDC1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103000583 (HKDC1)
Membrane trafficking [BR:bacu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103000583 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 103000583
NCBI-ProteinID: XP_007167830
LinkDB All DBs
Position
Un
AA seq 918 aa AA seqDB search
MFAVHLMAFYFTKLKEDQIKKVDRFLYHMRLSDETLLDVVARFQAEMQKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSEEGKRNVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKELMQKKLPLGLTFSFPCKQTKLEEGVLLSWTKKFKARGV
QGTDVVSSLTNAMRKHKQDLDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYM
EDMSNIELVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISG
LYLGELVRLILLKMAKAGLLFGGEKSSALHIKGKIETRHVAAMEKYKEGLANTREILTDL
GLEPSEADCVAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLARLRTTVGMDGTLYKI
HPQYPKRLHKVVRKLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFRL
TREQLVGVRDKMRVELEYGLKRDTHPLATVKMLPTYVCGMPDGTEKGKFLALDLGGTNFR
VLLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGF
TFSFPCRQAGIDKGTLIEWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVG
TMMTCGYEDRNCEVGLIAGTGSNMCYMEEMRNIELVEGDEGKMCINTEWGGFGDNGCLDD
IRTQYDKEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRG
IFETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAELYGAGLAA
VVEKRREDQGFEHLKITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKG
AALITAVAKRLQQARREN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtacacttgatggcattttacttcaccaagctgaaggaggatcagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgagacccttttggacgttgtg
gctcggttccaggctgagatgcagaagggcctggggaaggacaccaaccccacagcgtcg
gtgaagatgctgcccacctttgtcagggccattccagatggctcagaaaacggggagttt
ctttccctggatcttggaggatctaagtttcgagtcttgaaggtgcaagtctccgaagag
gggaaacgcaatgtccagatggagagtcagttctacccaacacccaatgaaattatccga
gggaatggcacagagctgtttgaatacgtagctgactgtctggcagatttcatgaaaacc
aaagagctgatgcagaagaaattacctctcggcctaaccttttcttttccctgcaaacag
actaaattagaagagggtgtcctgctttcatggacaaagaagtttaaggcgcggggagtt
cagggcacagacgtagtgagctctctgaccaatgctatgagaaaacacaagcaggattta
gatgtggacatcctggctttggtcaatgacaccgtggggaccatgatgacgtgcgcctat
gatgatccctactgtgaagttggtgtcatcattggcaccggcaccaacgcgtgctacatg
gaggacatgagcaacatcgagctggtggaaggtgacgaggggaggatgtgcatcaacacc
gagtggggggccttcggggacgacggggccctggaggacatccgcaccgagttcgaccgg
gagctggacctcggctctctcaaccccgggaagcagctgtttgagaagatgatcagcggc
ctgtacctaggtgaactcgtcaggctcatcttgctgaagatggccaaggcaggcctcctg
tttggcggcgagaaatcctccgctctccacattaagggcaagattgaaacacggcacgtg
gctgccatggagaagtataaagaaggcctggctaatacaagagagatcctgacggatctg
ggcctggagccttcagaggccgactgcgtcgcggtccagcacgtctgcaccatcgtttcc
ttccgctcagccaatctctgtgcggcggccctggcagccatcctaacacgcctgcgggag
aacaagaagctggcgcggctccggaccacggtgggcatggatggcacactctacaagatc
cacccccaatacccaaaacgcctgcacaaggtggtgaggaaactggtcccgaactgtgac
gtccgcttcctcctgtcagagagtggcagcaccaagggggccgccatggtgaccgcagtg
gcctcccgcgtgcaggcccagcggaagcagattgacaaggtgctggctttgttccggctg
acccgagagcaacttgtgggcgttcgggacaagatgcgggttgagctcgagtacgggctg
aagagggacacccacccgctggccacggtcaagatgctgcccacctacgtctgcgggatg
ccagatggcacagagaaaggcaagttcctcgccctggatctggggggaaccaacttccgg
gtcctcctggtgaagatcagaagcggacggaggtcggtgcgaatgtacaacaagatcttc
gccatccccctggagatcatgcagggcaccggcgaggagctgtttgaccacatcgtgcag
tgcatcgctgacttcctggactacatgggcctcaagggagcccagctgcctttgggcttc
acattctcatttccctgcaggcaggcgggcattgacaagggaacactcattgagtggacc
aaaggcttcaaggctactgactgtgaaggggaagatgtggtggacatgctcagggaagcc
atcaagaggagaaatgagtttgacctggacatagtcgcagttgtgaatgacacagtgggg
accatgatgacctgtggctatgaagatcgtaactgtgaggttggcctgattgcaggaaca
ggcagcaacatgtgctacatggaggagatgaggaacattgaactggtggaaggggatgaa
gggaagatgtgcataaacacagagtggggaggatttggagataatggctgcctagatgac
atccggacccagtacgacaaggaggtggatgaggggtccttgaatcctggcaaacagaga
tacgagaaaatgaccagtgggatgtacctgggggagatcgtgcggcagatcctgattgac
ttgaccaagcagggtctcctcttccgagggcagatttcagagcgtctccggaccaggggc
atctttgaaaccaagttcttgtctcaaattgaaagcgatcggctggccctcctccaggtc
aggaggatcctgcagcagcttggcctggacagcacgtgtgaggacagcatcgtggtgaag
gaggtgtgcggagctgtgtcccggcgggcggccgagctctacggtgccggcctggccgcc
gtcgtggagaaaaggagggaagaccaggggtttgagcacctgaagatcaccgtgggtgtg
gatggcaccctgtacaagctgcacccgcacttttctcggatattgcaggaaactgtgaaa
gaactagctcctcgatgtgatgtgacattcatgttgtcagaagatgggagtggaaaggga
gcagctctgatcactgctgtggccaagaggttacagcaggcacggagggagaactag

DBGET integrated database retrieval system