KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000872
Entry
103000872         CDS       T03086                                 

Gene name
CSNK1A1
Definition
(RefSeq) casein kinase 1 alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04340  Hedgehog signaling pathway
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103000872 (CSNK1A1)
   04340 Hedgehog signaling pathway
    103000872 (CSNK1A1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103000872 (CSNK1A1)
   05226 Gastric cancer
    103000872 (CSNK1A1)
   05224 Breast cancer
    103000872 (CSNK1A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103000872 (CSNK1A1)
   05022 Pathways of neurodegeneration - multiple diseases
    103000872 (CSNK1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103000872 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103000872 (CSNK1A1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103000872 (CSNK1A1)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   103000872 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 103000872
NCBI-ProteinID: XP_007188738
UniProt: A0A384AN40
LinkDB
Position
Un
AA seq 368 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGTWLVIQQR
KPYHRGRP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaattcattgtcggagggaaatataaactggta
cggaagatcgggtctggctccttcggtgacatttatctggcgatcaacatcaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaaactctataagattcttcaaggtggggttggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtgctagtcatggatcttcttggacccagccttgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcttaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtacttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatatagagaagataaaaatctcactggcactgctcgatatgctagcatcaatgca
catcttggtattgaacagagtcgccgagatgacatggaatcattaggatatgttttgatg
tattttaatagaaccagcctgccatggcaaggactaaaggctgcaacaaagaagcaaaag
tatgaaaaaattagtgaaaagaagatgtccacacctgttgaagttttatgtaagggattt
cctgcagaatttgccatgtacttaaactattgccgtgggctgcgctttgaggaagccccg
gattacatgtacctgaggcagctattccgcattcttttcaggaccctgaatcaccaatat
gactacacatttgattggacaatgttaaagcagaaagcagcacagcaggcagcctcttca
agtgggcagggtcagcaggcccaaacccccacaggaacgtggctggtcattcagcaacgt
aaaccatatcacaggggaagaccttga

DBGET integrated database retrieval system