KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000926
Entry
103000926         CDS       T03086                                 

Gene name
TRPV4
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04218  Cellular senescence
bacu04750  Inflammatory mediator regulation of TRP channels
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103000926 (TRPV4)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103000926 (TRPV4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103000926 (TRPV4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bacu04040]
    103000926 (TRPV4)
Ion channels [BR:bacu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   103000926 (TRPV4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_3 Ank_4 Ank_5
Other DBs
NCBI-GeneID: 103000926
NCBI-ProteinID: XP_007180172
UniProt: A0A383ZYG9
LinkDB
Position
Un
AA seq 871 aa
MADPSEGPRVGPGEVAEPPGDESGIPGGEAFPLSSLANLFEGEDGSPSPSPADSGRPAGP
GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRQHPSDN
KRWRRKVIEKQPQSPKAPTPQPPPILKVFNRPILFDIVSRGSTADLDGLLPFLLTHKKRL
TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIADRTGNMREFINSPFRDIYYRGQT
ALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCARLFPDS
NLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEASVLEILVYNSRIENRHEMLAVEPINELLRDKWRKFGAVSFYINVASYLC
AMVIFTLTAYYQPLEGTPPYPYLTTVDYLRLAGEIITLFTGVLFFFTNIRDLFMKKCPGV
NSLFVDGSFQLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG
TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCANMKMCSEDHTNCTVPTYPSC
RDSETFSTFLLDLFKLTIGMGDLEMLSSTKYPVVFIILLVTYIILTFVLLLNMLIALMGE
TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV
DEVNWSHWNQNLGIINEDPGKNENYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDE
VVVPLDNVGNPSCDGHQKSYPPRWRTDDAPL
NT seq 2616 nt   +upstreamnt  +downstreamnt
atggcggatcccagcgaaggcccccgcgtggggcctggggaggtagccgagccccctggg
gatgagagtggcatccccggcggggaggccttccccctctcttcgctggccaacctgttc
gagggggaggacggctccccgtcaccctctccggccgatagtggtcgccccgccggccca
ggcgatgggcgaccaaacctgcgcatgaagttccagggcgccttccgcaagggggtgccc
aaccccatcgacctgctggagtccaccttgtatgagtcctcggtggtgcctgggcccaag
aaggcgcccatggactcgctctttgactatggcacctatcgccagcaccccagtgacaac
aagcggtggaggaggaaggtcatagagaagcagccacagagccccaaagctcccacaccc
cagccgcctcccatactcaaagtcttcaaccggcctatcctctttgacatcgtgtctcgg
ggctccaccgctgacctggacgggctgctccccttcttgctgacccacaagaagcggctg
actgacgaggagttccgggagccatccacggggaagacctgcctgcccaaagccctgctg
aatctgagcaacggccgcaatgacacaatccctgtgcttctggacatcgctgatcgcacg
ggcaacatgcgcgagttcatcaactcgcccttccgggacatctactaccgaggccagact
gccctgcacatcgccattgagcgccgctgcaaacactatgtggagctcctggtggcccaa
ggtgccgatgttcacgcccaggcccggggacgcttcttccagcccaaggatgagggaggc
tacttctactttggcgagctgcccctgtcgctggcggcctgcaccaaccagccccacatc
gtcaactacctgacagagaacccgcacaagaaggcggacatgcggcgccaggactcccgt
ggcaacacagtgctgcacgcgctggtggccatcgcggacaacactcgcgagaacaccaag
ttcgtcaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagc
aacctggaggccgtgctcaacaacgacggcctctcgcccctcatgatggccgccaagacg
ggcaagatcgggatctttcagcacatcatccgtcgggaggtgacagacgaggacaccagg
catctatcccgcaagttcaaggactgggcctacgggccagtgtattcctcactctatgac
ctctcctccctggacacgtgtggggaagaggcctctgtgctggagatcctggtgtacaac
agcaggatcgagaaccgccatgagatgctggccgtggaacccatcaatgaactacttcgg
gacaagtggcgaaagttcggggccgtttctttctacatcaacgtggcctcctatctgtgc
gccatggtcatctttaccctcaccgcctactaccagcctctggagggcactccgccatac
ccttacctcaccacggtggactacctgaggctggccggcgagatcatcacgctcttcacc
ggggtcctgttctttttcaccaacatcagagacttgttcatgaagaaatgccctggagtg
aattctctcttcgtcgatggctccttccaactactctacttcatctactctgtgctggtg
atagtctcggcagccctctacctggcggggattgaggcctacctggccgtcatggtcttt
gccttggtcctgggctggatgaacgccctttacttcacccgtgggctgaagctgacgggg
acctatagcatcatgatccagaagatcctcttcaaagatcttttccgcttcctgctggtc
tacttgctcttcatgattggctacgcttcagccctggtctccctcctgaacccgtgtgcc
aacatgaagatgtgcagcgaggaccacaccaactgcacagtgcccacgtacccctcgtgc
cgtgacagcgagaccttcagcaccttcctcctggacctcttcaagctgaccatcggcatg
ggcgacctggagatgctgagcagcaccaagtaccccgtggtcttcatcatcctgctcgtc
acctacatcatcctcacgttcgtgctgctcctcaacatgctcatcgccctcatgggggag
acggtgggccaggtgtccaaggagagcaagcacatctggaagctgcagtgggccaccacc
atcctggacatcgagcgctccttccctgtgttcctgaggaaggccttccgctccggcgag
atggtgaccgtgggcaagagctcggacggcactccagaccgcaggtggtgcttcagggtg
gacgaggtaaactggtctcactggaaccagaacttgggcatcattaacgaggaccccggc
aagaacgagaactaccagtattacggcttctcgcacaccgtgggccgcctccggagggat
cgttggtcctcggtggtgccccgcgtggtggagctgaacaagaactcgaacccggacgag
gtggtggtgcctctggacaacgtggggaaccccagctgtgacggccaccagaagagttat
ccccccaggtggaggactgacgacgcccccctctag

DBGET integrated database retrieval system